| Protein: 110764028+2_252680 252680 to 253876 1197 bases. (338 amino acid fragment with 18 peptide hits) sequence correction |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 99.1* | 0.9 | 110.11111 | ||
| Scape | 0.2* | 90.8* | 9 | 0.022222223 | 10.088889 |
| Brain | |||||
| Crop | 58.3 | 41.7 | 1.3980815 | ||
| Eye | |||||
| Intestine | 0.6* | 80.6* | 18.7 | 0.03208556 | 4.3101606 |
| Leg, front | 0.1* | 91.6* | 8.2 | 0.012195122 | 11.170732 |
| Leg, middle | 0.1* | 89.4* | 10.5 | 0.00952381 | 8.514286 |
| Leg, rear | 0.4* | 76.5* | 23.1 | 0.017316017 | 3.3116884 |
| Mandibular gland | 10.7 | 15 | 74.4 | 0.1438172 | 0.2016129 |
| Rectum | 38.4 | 61.6 | 0.6233766 | ||
| Salivary gland, cerebral | 0.4* | 67.2 | 32.4 | 0.012345679 | 2.074074 |
| Salivary gland, thoracic | 2.8* | 75.2* | 22 | 0.12727273 | 3.418182 |
| Sternite | 94.9* | 5.1 | 18.607843 | ||
| Tergite | 0.3* | 49.9 | 49.8 | 0.006024096 | 1.0020081 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 0.9* | 32.2 | 66.8 | 0.013473054 | 0.48203593 |
| Malpighian tubules | 1* | 65.8 | 33.3 | 0.03003003 | 1.975976 |
| Nerve chord | 0.5* | 87.2* | 12.2 | 0.040983606 | 7.147541 |
| Poison sac | |||||
| Sting | 26.6 | 73.4 | 0.36239782 | ||
| Heart | 0.7* | 68 | 31.3 | 0.022364218 | 2.172524 |
| Hypopharyngeal gland | |||||
| Galea | 83.5* | 16.5 | 5.060606 | ||
| Glossa | 0.5* | 53.3 | 46.2 | 0.010822511 | 1.1536796 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 1.4 | 67.2 | 31.9 | 0.043887146 | 2.106583 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
CNVCTLDGKLVKVRRDVDTINIFELNITSIDENNTFEDIVAIKLSFSIGNNISSVKKESF KGLELLRELDLGNNMIPLSPYLFSELKQLRTLNLKNNNLEEIPKDSFAGLSNLKKLYLQR NRIQLLDNDSFSGLSSLGMLQLDNNRISNLNAESMCRIPKLEELHLMNNTLTSVQPGSLA CLRDLKFVNFAFNRLTRLSKTDFEGLTNVETMNLRNNRIAAIDPETFSHMKKLQTLFMTS NQLTMIDPRLFNGLTALNWLELNSNNIDTLEAGSFADLNKLRVLHLEDNNLSEVDREKVG LTNSTDLIIFQGNTTTKESSEQESKIMSLYWLIILNGK |
 Top
| |