| Protein: 66524277 XP_623354.1 PREDICTED: protein enhancer of sevenless 2B |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 31.6 | 35.6 | 32.7 | 0.96636087 | 1.088685 |
| Scape | 52.1 | 19.9 | 28 | 1.8607143 | 0.7107143 |
| Brain | |||||
| Crop | 53 | 24.5 | 22.5 | 2.3555555 | 1.0888889 |
| Eye | |||||
| Intestine | |||||
| Leg, front | 53 | 47 | 1.1276596 | ||
| Leg, middle | 56.7 | 43.3 | 1.3094689 | ||
| Leg, rear | |||||
| Mandibular gland | 50.4 | 49.6 | 1.016129 | ||
| Rectum | |||||
| Salivary gland, cerebral | 26.6 | 73.4 | 0.36239782 | ||
| Salivary gland, thoracic | 26.7 | 43.3 | 30 | 0.89 | 1.4433334 |
| Sternite | 50.5 | 25.3 | 24.2 | 2.086777 | 1.0454545 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 10.8 | 65.3 | 23.8 | 0.45378152 | 2.7436974 |
| Malpighian tubules | |||||
| Nerve chord | 36 | 31.6 | 32.4 | 1.1111112 | 0.97530866 |
| Poison sac | |||||
| Sting | |||||
| Heart | 43.5 | 28.1 | 28.5 | 1.5263158 | 0.9859649 |
| Hypopharyngeal gland | |||||
| Galea | 44.1 | 55.9 | 0.7889088 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 42.4 | 33.4 | 37.8 | 1.1216931 | 0.8835979 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MEAIAKHDFTATAEDELSFRRSQILKILNMEDDMNWYRAELDSREGLIPSNYIEMKNHDW YYGRITRADAERLLMNKHEGAFLIRISESSPGDFSLSVKCSDGVQHFKVLRDAQGKFFLW VVKFNSLNELVEYHRTASVSRSQDVKLRDMVPEECLVQALYDFQPQEPGELEFKRGDVIT VTDRTDQHWWHGEIGNRRGLFPSTYVTPYHS |
 Top
| |