| Protein: 328785752 XP_003250651.1 PREDICTED: hsc70-interacting protein-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 43.7 | 27.3 | 29 | 1.5068965 | 0.9413793 |
| Scape | 41.7 | 23.6 | 34.7 | 1.201729 | 0.6801153 |
| Brain | 24.2 | 75.8 | 0.31926122 | ||
| Crop | 41.2 | 27.3 | 31.5 | 1.3079365 | 0.8666667 |
| Eye | |||||
| Intestine | 28.2 | 41.9 | 29.8 | 0.94630873 | 1.4060403 |
| Leg, front | 56.1 | 43.9 | 1.2779043 | ||
| Leg, middle | 59.4 | 40.6 | 1.4630542 | ||
| Leg, rear | 58.6 | 41.4 | 1.4154589 | ||
| Mandibular gland | |||||
| Rectum | 35 | 65 | 0.53846157 | ||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 30.7 | 35.6 | 33.7 | 0.9109792 | 1.0563798 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 40.9 | 27.1 | 32 | 1.278125 | 0.846875 |
| Malpighian tubules | 25.1 | 51.1 | 23.8 | 1.0546218 | 2.1470587 |
| Nerve chord | 7.5 | 48.9 | 43.6 | 0.17201835 | 1.1215596 |
| Poison sac | |||||
| Sting | |||||
| Heart | 55.4 | 44.6 | 1.2421525 | ||
| Hypopharyngeal gland | 39.1 | 60.9 | 0.64203614 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.3 | 39.8 | 42 | 0.8404762 | 0.947619 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGDFYKFLNDPDVLQAFMDPEVAEAFKEISTNPTNILKYQSNPKIMAFINKMASKFGGAG GFPGMMGGMPGFPGAGNTQTTPKPKPQDDVGLD |
 Top
| |