| Protein: 328792177 XP_392125.2 PREDICTED: hypothetical protein LOC408583 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 41.9 | 20.6 | 37.5 | 1.1173333 | 0.54933333 |
| Scape | 52.3 | 24.8 | 22.9 | 2.2838428 | 1.0829694 |
| Brain | 53.8 | 22.8 | 23.4 | 2.2991452 | 0.974359 |
| Crop | 36.3 | 7.3* | 56.4 | 0.64361703 | 0.12943262 |
| Eye | 6 | 45.4 | 48.6 | 0.12345679 | 0.93415636 |
| Intestine | 39.4 | 26.1 | 34.6 | 1.1387284 | 0.7543353 |
| Leg, front | 33.4 | 33 | 33.6 | 0.99404764 | 0.98214287 |
| Leg, middle | 22.7 | 39.1 | 38.2 | 0.59424084 | 1.0235602 |
| Leg, rear | 34.4 | 49.4 | 16.2 | 2.1234567 | 3.0493827 |
| Mandibular gland | 45.2 | 1.3 | 53.5 | 0.84485984 | 0.024299065 |
| Rectum | 53.3 | 6.6 | 40 | 1.3325 | 0.165 |
| Salivary gland, cerebral | 5 | 48.2 | 46.7 | 0.10706638 | 1.0321199 |
| Salivary gland, thoracic | 90.3* | 2.3 | 7.4 | 12.202703 | 0.3108108 |
| Sternite | 19.7 | 24.4 | 55.9 | 0.35241503 | 0.43649372 |
| Tergite | 11.8 | 27.9 | 60.3 | 0.19568823 | 0.46268657 |
| Ventriculus | 17.4 | 20.5 | 62.1 | 0.28019324 | 0.33011273 |
| Thoracic muscle | 4.2 | 91.9 | 3.9 | 1.0769231 | 23.564102 |
| Fat body | 93.4* | 4.5 | 2.1 | 44.47619 | 2.142857 |
| Malpighian tubules | 44.9 | 24.6 | 30.4 | 1.4769737 | 0.80921054 |
| Nerve chord | 55.8 | 17.3 | 27 | 2.0666666 | 0.64074075 |
| Poison sac | 61.9 | 38.1 | 1.6246719 | ||
| Sting | 62 | 38 | 1.6315789 | ||
| Heart | 26.6 | 35.4 | 38 | 0.7 | 0.93157893 |
| Hypopharyngeal gland | 96.4 | 3.6 | 26.777779 | ||
| Galea | 28.6 | 37.6 | 33.8 | 0.84615386 | 1.112426 |
| Glossa | 27.3 | 37.3 | 35.4 | 0.7711864 | 1.0536723 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.7 | 33.4 | 34.1 | 1.0762464 | 0.97947216 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MDAIKKKMQGMKLEKDNAMDRALLCEQQARDANARAEKAEEEARALQKKIQTIENELDQT QEALMQVNAKLEEKDKALQNSTLKRVVERRGLVKGWQLVSMEPALTSTTRRRGHQHHPRH ATRRRLDASSRGPAQCGPADIVKDTAIRNNETSTTTTSPKLDEKSNVIDTECSTAVTVPT IGTRWLRDPTATVSTKDVTSNEDSNKIKYNIEHDREENIRHRLAQCSLDVIDERHEQFVR KRNENENFDSYKMEKVLDNSESKSCGNEICENESDEEKRNNENSPEPEHAVARARGDGNS DDESTNVEEDPELAELAKLRCPSERTEVQAEREAKRRKRCADYPGLAFGWSIFSSDTMMK FGLIRNELQNIMGNQLKRAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAADE SERARKILENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEER AEAGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTSRLKEAEARAEFA ERSVQKLQKEVDRLEDELVHEKEKYKYICDDLDLTFTELIEKN |
 Top
| |