| Protein: 328788820 XP_001122973.2 PREDICTED: hypothetical protein LOC727263 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 66.4 | 33.6 | 1.9761904 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 7.3 | 92.7 | 0.07874865 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 30 | 70 | 0.42857143 | ||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 63.5 | 26.5 | 10 | 6.35 | 2.65 |
| Malpighian tubules | 33.8 | 66.2 | 0.51057404 | ||
| Nerve chord | 73.7 | 26.3 | 2.8022814 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 45.2 | 54.8 | 0.82481754 | ||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 44.7 | 41 | 50.5 | 0.8851485 | 0.8118812 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MRRLSMKTKHTKSETSNSNSEENGVGHLTIVDNNNEMKKGKENKNAESPRRGTPKKRPSR NRHSQKETTENSTLKSEIEDTQAVDREEENKNVGKAGPSKRLKKEDQKTSSLIKQEGNNE KEYEVEKIVSQRTIKGQRQFLVRWKGYGEDSDTWEQEKDLSCPELIEEFLAENTENEEDI KAKRLEISPKSPKNKVDKKSKKPKNNTKKQTENGKQVIASDEEKDIKDDQKEFEVEKIIE VHFKKNKTREFLIRWKGFTSADDTWEPEENLNCPELIAKFMQKVEKAKITEARELRANRP HTKRYTLTTHEHGRRLSRRNMDKQRATYHECDE |
 Top
| |