| Protein: 328779779 XP_003249702.1 PREDICTED: 40S ribosomal protein S28-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 60.3* | 19.1 | 20.5 | 2.9414635 | 0.9317073 |
| Scape | 41.3 | 24 | 34.7 | 1.1902018 | 0.69164264 |
| Brain | 51.4 | 48.6 | 1.0576131 | ||
| Crop | 27.3 | 35.6 | 37.1 | 0.7358491 | 0.95956874 |
| Eye | |||||
| Intestine | 35.4 | 32.6 | 32 | 1.10625 | 1.01875 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 35.4 | 64.6 | 0.54798764 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 36.4 | 30.6 | 33 | 1.1030303 | 0.92727274 |
| Sternite | 13.9 | 41 | 45.1 | 0.308204 | 0.90909094 |
| Tergite | 40.1 | 59.9 | 0.6694491 | ||
| Ventriculus | 55.5 | 44.5 | 1.247191 | ||
| Thoracic muscle | 31.6 | 68.4 | 0.4619883 | ||
| Fat body | 33.1 | 40.5 | 26.4 | 1.2537879 | 1.5340909 |
| Malpighian tubules | 33.1 | 29.4 | 37.5 | 0.88266665 | 0.784 |
| Nerve chord | 39.2 | 24.2 | 36.6 | 1.0710382 | 0.6612022 |
| Poison sac | |||||
| Sting | 60.4 | 39.6 | 1.5252526 | ||
| Heart | 20.7 | 52.1 | 27.2 | 0.7610294 | 1.9154412 |
| Hypopharyngeal gland | 42.9 | 57.1 | 0.7513135 | ||
| Galea | 45.2 | 54.8 | 0.82481754 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.4 | 39 | 42.6 | 0.80751175 | 0.91549295 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MDKPVVLARVIKVLGRTGSQGQCTQVKVEFLGEQNRQIIRNVKGPVREGDLLTLLESERE ARRLR |
 Top
| |