| Protein: 66550890 XP_625114.1 PREDICTED: phosphoglycerate mutase 2-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 33.2 | 40 | 26.8 | 1.238806 | 1.4925373 |
| Scape | 23.9 | 37 | 39.1 | 0.6112532 | 0.94629157 |
| Brain | 63.9 | 13.2 | 22.9 | 2.790393 | 0.57641923 |
| Crop | 32.8 | 17.4 | 49.8 | 0.65863454 | 0.3493976 |
| Eye | 39 | 33.9 | 27.1 | 1.4391143 | 1.2509226 |
| Intestine | 25.9 | 31 | 43.1 | 0.60092807 | 0.71925753 |
| Leg, front | 38.7 | 30.9 | 30.3 | 1.2772278 | 1.019802 |
| Leg, middle | 33.6 | 33.5 | 32.8 | 1.0243902 | 1.0213414 |
| Leg, rear | 32.6 | 30.6 | 36.8 | 0.88586956 | 0.83152175 |
| Mandibular gland | 24.1 | 38.4 | 37.6 | 0.6409575 | 1.0212766 |
| Rectum | 26.4 | 48.9 | 24.7 | 1.068826 | 1.9797571 |
| Salivary gland, cerebral | 28.4 | 25.3 | 46.2 | 0.6147186 | 0.54761904 |
| Salivary gland, thoracic | 33.2 | 34.5 | 32.3 | 1.0278637 | 1.0681114 |
| Sternite | 48 | 41.8 | 10.2 | 4.7058825 | 4.098039 |
| Tergite | 66.1 | 18.3 | 15.6 | 4.2371793 | 1.1730769 |
| Ventriculus | 26 | 31.9 | 42.2 | 0.6161137 | 0.75592417 |
| Thoracic muscle | 21.2 | 67.3 | 11.5 | 1.8434782 | 5.852174 |
| Fat body | 58.3 | 25.6 | 16.2 | 3.5987654 | 1.5802469 |
| Malpighian tubules | 29.4 | 39.8 | 30.8 | 0.95454544 | 1.2922078 |
| Nerve chord | 28.3 | 41.9 | 29.7 | 0.95286196 | 1.4107745 |
| Poison sac | 34 | 66 | 0.5151515 | ||
| Sting | 51 | 49 | 1.0408163 | ||
| Heart | 49.3 | 20.8 | 29.9 | 1.6488295 | 0.6956522 |
| Hypopharyngeal gland | 63.4 | 36.6 | 1.7322404 | ||
| Galea | 25.1 | 29.9 | 45 | 0.55777776 | 0.66444445 |
| Glossa | 30.4 | 23.1 | 46.5 | 0.6537634 | 0.4967742 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.6 | 34.7 | 33.8 | 1.0532545 | 1.0266272 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFLSNILNKALVQLKNTIGGGGFQLNQLGRNIEQRSVLTNRVLISFLRGISSGKKSKKMS KYTIVMVRHGESEWNKLNLFCGWYDSHLSDKGKIEAISAGKAIRDAKFTFDIAHTSLLSR AQDTLKAILKEIGQENITVQKTWRLNERHYGGLTGLNKAETAAKYGEEQVQIWRRSFDTP PPPMEPDHKYYEIIVNDPRYANDPKPEEFPKFESLKLTIERTLPYWNNTIIPQLKEGKRI IIAAHGNSLRGIVKHLDEMSNDEIMKLNLPTGIPFVYELDENFKPVVSMKFLGDEETVKA AMAAVAAQAKVK |
 Top
| |