| Protein: 66517185 XP_391836.2 PREDICTED: mitochondrial import receptor subunit TOM40 homolog 1-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 47.9 | 52.1 | 0.9193858 | ||
| Scape | 45.9 | 20.8 | 33.3 | 1.3783784 | 0.6246246 |
| Brain | 41.7 | 58.3 | 0.71526587 | ||
| Crop | |||||
| Eye | 51.2 | 48.8 | 1.0491803 | ||
| Intestine | 38.8 | 61.2 | 0.63398695 | ||
| Leg, front | |||||
| Leg, middle | 59.2 | 40.8 | 1.4509804 | ||
| Leg, rear | |||||
| Mandibular gland | 9.3 | 90.7 | 0.10253583 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 40.8 | 59.2 | 0.6891892 | ||
| Sternite | 63.3 | 36.7 | 1.7247957 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 21.2 | 32.7 | 46.1 | 0.45986986 | 0.7093276 |
| Malpighian tubules | 37.6 | 30.9 | 31.4 | 1.1974522 | 0.98407644 |
| Nerve chord | 48.2 | 51.8 | 0.93050194 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 27.7 | 41.3 | 31 | 0.89354837 | 1.3322581 |
| Hypopharyngeal gland | 62.6 | 37.4 | 1.6737968 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.6 | 43.5 | 48.5 | 0.75463915 | 0.8969072 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGNVLAASVPPPPSPPPPTSGLLPNLEKPDSSETLNSSSRLSDGLKNPGTIEDLHKKCKD VFPANFEGAKLMFNKGLSNHFQISHTISMSSIAQSGYRFGATYVGTQQPVPSEAYPVLLG DIDPSGNLNANIIHQFGERLRGKLATQVQKSKFTAVQMTTDYRGDAYTVSLTLGNPDILN GSGVFVMHYLQSITPSVALGGELAYQRGPAVPGGQVAVLSAAGRYTNGDSTISGSLGLSG CHLCFHQKASQQLQVGVELEINCRIQESTGAIAYQIDLPKADLIFRGSVDTNWTVGAVLE KKLQPLPFTFALSGMINHSKPQFRLGCGLIIG |
 Top
| |