| Protein: 328783826 XP_395784.2 PREDICTED: stomatin-like protein 2-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 19.3 | 41 | 39.7 | 0.4861461 | 1.0327456 |
| Scape | 33.9 | 35.2 | 30.8 | 1.1006494 | 1.1428572 |
| Brain | 43.6 | 56.4 | 0.77304965 | ||
| Crop | 30.2 | 45.5 | 24.4 | 1.2377049 | 1.8647541 |
| Eye | |||||
| Intestine | 38.7 | 61.3 | 0.6313214 | ||
| Leg, front | 43.9 | 56.1 | 0.7825312 | ||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 21.5 | 31.8 | 46.7 | 0.46038544 | 0.6809422 |
| Salivary gland, thoracic | 44 | 20.7 | 35.4 | 1.2429378 | 0.58474576 |
| Sternite | 23.2 | 36.3 | 40.5 | 0.5728395 | 0.8962963 |
| Tergite | 24.5 | 24.1 | 51.4 | 0.4766537 | 0.4688716 |
| Ventriculus | |||||
| Thoracic muscle | 44.9 | 31.1 | 24 | 1.8708333 | 1.2958333 |
| Fat body | 16.8 | 42.5 | 40.7 | 0.4127764 | 1.044226 |
| Malpighian tubules | 37 | 33.4 | 29.6 | 1.25 | 1.1283784 |
| Nerve chord | 36.4 | 31.3 | 32.2 | 1.1304348 | 0.9720497 |
| Poison sac | |||||
| Sting | 57.5 | 42.5 | 1.3529412 | ||
| Heart | 27.6 | 34.8 | 37.6 | 0.7340425 | 0.9255319 |
| Hypopharyngeal gland | 81.9 | 18.1 | 4.524862 | ||
| Galea | 35.3 | 64.7 | 0.54559505 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29.9 | 39.4 | 40.7 | 0.73464376 | 0.96805894 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLVNIMLLRTYKWEMNCRFKQFARNFGIIKFQPLLEFEHTVRKFPVTQLVRCKSGTPMNT IILFVPQQEAWIVERMGKFHRILNPGLNILTPIIDKIKYVQCLKEIAIEIPQQSAVTSDN VTLNIDGILYLRVVNPFLASYGVDDPEFAVVQLAQTTMRSELGKISLDKVFREREGLNVC IVDSINKASEAWGITCLRYEIRDIRLPQRVQEAMQMQVEAERKKRAAVLESEGAREAEIN IAEGKRLAQILASEAAKQEEINKATGTATALVAIAEARAKSLKLVAGALNLTDAKNAAAY SIAEQYVKAFNKLAKVNNTLILPSNVSDVSALVTQAMTIYKQVMSQPTLDSPDVKENKDL LNDDESDETFEYFSDKEEAEKHRRSKRKRNPKAL |
 Top
| |