| Protein: 328785544 XP_396670.3 PREDICTED: lamin Dm0-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 12.1* | 38.6 | 49.3 | 0.2454361 | 0.7829615 |
| Scape | 47.8 | 16.1 | 36.1 | 1.3240998 | 0.44598338 |
| Brain | |||||
| Crop | 14.5 | 63.8* | 21.7 | 0.66820276 | 2.940092 |
| Eye | |||||
| Intestine | 81.8* | 18.2 | 4.4945054 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 35.1 | 64.9 | 0.54083204 | ||
| Mandibular gland | |||||
| Rectum | 63 | 12.5 | 24.5 | 2.5714285 | 0.5102041 |
| Salivary gland, cerebral | 64.3 | 3.4 | 32.4 | 1.9845679 | 0.10493827 |
| Salivary gland, thoracic | 52.7 | 47.3 | 1.114165 | ||
| Sternite | 13.5 | 27.8 | 58.7 | 0.22998296 | 0.47359455 |
| Tergite | 11.7 | 47.3 | 40.9 | 0.28606358 | 1.1564792 |
| Ventriculus | 49.3 | 50.7 | 0.9723866 | ||
| Thoracic muscle | |||||
| Fat body | 65.3 | 17.3 | 17.4 | 3.7528737 | 0.99425286 |
| Malpighian tubules | 27.3* | 10.4* | 62.3 | 0.43820223 | 0.16693419 |
| Nerve chord | 95.6* | 1.5 | 2.9 | 32.96552 | 0.51724136 |
| Poison sac | |||||
| Sting | 56.7 | 43.3 | 1.3094689 | ||
| Heart | 38.5 | 31.3 | 30.2 | 1.2748344 | 1.0364238 |
| Hypopharyngeal gland | 75.1 | 24.9 | 3.0160642 | ||
| Galea | 30.3 | 42.5 | 27.3 | 1.1098901 | 1.5567765 |
| Glossa | 33.3 | 45.3 | 21.4 | 1.5560747 | 2.1168225 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 42.8 | 34.8 | 35.5 | 1.2056338 | 0.9802817 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSTKASKKTTATSSSNVQSPQFTSTPIGQRPGSPLSPTRYSRLQEKQDLQNLNDRLACYI DKVRHLESENSRLTREVQTTQETITREVSNIKSMYEHELSDARKLLDDTAKERAKLEIDT KRLWDNNEELKSKLDKKLVDLQVAERNLLLYETRYNDLQSQFNQSQAERKKLAERERELE QEVEKLKALLEDARKHLGEETLQRIVLENNIQSLKEDISFKDQIYQQELTESRTKRQIEI SEIDGRLAEKYEAKLQQSLQELRDQYEAQMRANREEIELLYENKIKNLTAHAQRNSGAAS LAVEELRQTRTRIDTLNQKINELEAANNALTARIRDLENLRENEKARHAESVASLEEELA RIRDEMAQQLKEYQDLMDIKIGLDLEIAAYRKLLESEESRLNINPVQSSSTASSGRTTPS RHTPLRGGKRKRTLLEESEERTSTDYSVSGTSRGDIEITEADPQGRFVKLTNKGNKEMGL SGWQIIRKAGSLETVFKFHRTAKLEAGATVMVWSADIGASHEPPSNIVMKGQKWFTADIM TTILLNNEGEEMASSECKRQQLSTSLSRHRENLGFRPSEELHHQQGDPQGEEFCRLM |
 Top
| |