| Protein: 328786023 XP_623841.3 PREDICTED: RNA-binding protein lark-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 26.5 | 73.5 | 0.3605442 | ||
| Scape | 35.7 | 64.3 | 0.55520993 | ||
| Brain | |||||
| Crop | 29.1 | 36.5 | 34.4 | 0.8459302 | 1.0610465 |
| Eye | |||||
| Intestine | 43.2 | 56.8 | 0.7605634 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 20.2 | 40.9 | 38.8 | 0.52061856 | 1.0541238 |
| Sternite | 54.6 | 45.4 | 1.2026432 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 44.1 | 36.1 | 19.8 | 2.2272727 | 1.8232323 |
| Malpighian tubules | 35 | 31.3 | 33.6 | 1.0416666 | 0.93154764 |
| Nerve chord | 59 | 12.5 | 28.4 | 2.0774648 | 0.44014084 |
| Poison sac | |||||
| Sting | |||||
| Heart | 25.9 | 42.7 | 31.4 | 0.8248408 | 1.3598726 |
| Hypopharyngeal gland | 40.1 | 59.9 | 0.6694491 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.5 | 37.6 | 44.2 | 0.78054297 | 0.85067874 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MPGFSSVGTFKIFIGNLADKTTNADIKPLFEKYGKVVECDVVKNYGFVHMENEEAGRNAI QNLNGHIVHGQEIKCEAAKSRKGPNTPTTKIFVGNLTDNTKAPQVRELFAKYGTVVECDI VRNYGFVHLEATGDVNDAIKELNGRMVDGQAMKVQISTSRVRQRPGMGDPEQCYRCGRGG HWSKECPKGGMGGGPDRNGYRDRMFGRDPYPPPPPPPFLRDRLMGGGRFGDYESYYDRRG FEDTRDLYERRFTGMTGPCDMGSSMCGLDFPPMTMPPLPPRRDPMPPMPPLGMGSMRDTG FSRGNEYGMFSRRSPPPSGNNGRFSRGMYEDFSRDSFEERRPGLRGPSPSRRFAPY |
 Top
| |