| Protein: 66500451 XP_623117.1 PREDICTED: ras-related protein Rab-39A |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 18 | 82 | 0.2195122 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 46.8 | 53.2 | 0.87969923 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 34.8 | 33.4 | 31.8 | 1.0943396 | 1.0503144 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 40.7 | 59.3 | 0.68634063 | ||
| Malpighian tubules | 50.6 | 49.4 | 1.0242915 | ||
| Nerve chord | 52.1 | 47.9 | 1.0876827 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 19.7 | 41.2 | 39.1 | 0.50383633 | 1.0537084 |
| Hypopharyngeal gland | 75.6 | 24.4 | 3.0983605 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.3 | 43.3 | 48.4 | 0.7913223 | 0.8946281 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVEPIFDYQFRLILIGDSTVGKSSLLKYFTDGKFAELSDPTVGVDFFARLIEVKDGTRIK LQLWDTAGQERFRSITKSYYRNSVGALLVYDVCNRASFEHIPQWMMDARRHIEPHRPVFA LVGCKLDLVTNGSRREVSKEEARAFADEHGVHHIETSAKTGVNVEEAFRTVTQEVYNRIQ TGEYKVEDGWDGIKTGFARPGGLDFNLVEAEPAKSSCC |
 Top
| |