| Protein: 48107260 XP_393089.1 PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 38.7 | 29.4 | 31.8 | 1.2169812 | 0.9245283 |
| Scape | 46.9 | 17.1 | 36 | 1.3027778 | 0.475 |
| Brain | 74.1* | 25.9 | 2.8610039 | ||
| Crop | 43.5 | 56.5 | 0.7699115 | ||
| Eye | 48 | 19.7 | 32.2 | 1.4906832 | 0.61180127 |
| Intestine | 38.7 | 27.3 | 34 | 1.1382353 | 0.8029412 |
| Leg, front | 31.4 | 29.2 | 39.4 | 0.79695433 | 0.74111676 |
| Leg, middle | 40.9 | 27.5 | 31.6 | 1.2943038 | 0.87025315 |
| Leg, rear | 13.1 | 23.6 | 63.3 | 0.20695102 | 0.3728278 |
| Mandibular gland | 54.6 | 45.4 | 1.2026432 | ||
| Rectum | 78.5 | 21.5 | 3.6511629 | ||
| Salivary gland, cerebral | 19.6 | 39.2 | 41.2 | 0.47572815 | 0.9514563 |
| Salivary gland, thoracic | 35.3 | 38.5 | 26.2 | 1.3473282 | 1.4694656 |
| Sternite | 29.2 | 32.9 | 37.9 | 0.77044857 | 0.8680739 |
| Tergite | 27.3 | 25.3 | 47.4 | 0.5759494 | 0.5337553 |
| Ventriculus | |||||
| Thoracic muscle | 23.1 | 42.7 | 34.2 | 0.6754386 | 1.248538 |
| Fat body | 20.7 | 55.3 | 24 | 0.8625 | 2.3041666 |
| Malpighian tubules | 41 | 24.7 | 34.3 | 1.1953353 | 0.7201166 |
| Nerve chord | 45.5 | 20.3 | 34.2 | 1.3304094 | 0.59356725 |
| Poison sac | |||||
| Sting | 37.1 | 62.9 | 0.5898251 | ||
| Heart | 53.9 | 18.1 | 28 | 1.925 | 0.6464286 |
| Hypopharyngeal gland | 83.7 | 16.3 | 5.134969 | ||
| Galea | 40.6 | 33.4 | 26 | 1.5615385 | 1.2846154 |
| Glossa | 47.4 | 14.2 | 38.4 | 1.234375 | 0.36979166 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.9 | 34 | 36.2 | 1.0745857 | 0.9392265 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAELPSGLISHTRKVCNLYKRALRTLESFNYKRHEYRYEAILLRQRFEKNRYIPDARIAK KLLLEGEEELFKKSHWEPLKFPDSPGGIAHGRFVEPPDAVLDFWDPIEKAQYPKYFGQRE KLKIEYEKLYKKLYLDNKETSKSNK |
 Top
| |