| Protein: 237681308 NP_001153742.1 glutathione S-transferase S1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 11.8* | 52.6 | 35.6 | 0.33146068 | 1.4775281 |
| Scape | 22.6 | 42.6 | 34.9 | 0.6475645 | 1.2206304 |
| Brain | 52.8 | 47.2 | 1.1186441 | ||
| Crop | 17.2 | 61.6* | 21.3 | 0.80751175 | 2.8920188 |
| Eye | |||||
| Intestine | 52.3* | 35.1* | 12.6 | 4.1507936 | 2.7857144 |
| Leg, front | 34.2 | 16.3* | 49.5 | 0.6909091 | 0.32929292 |
| Leg, middle | 30.1 | 13.6* | 56.4 | 0.53368795 | 0.24113475 |
| Leg, rear | 28.6 | 12.2* | 59.2 | 0.4831081 | 0.20608108 |
| Mandibular gland | 71.4 | 28.6 | 2.4965036 | ||
| Rectum | 24.2 | 50.6 | 25.1 | 0.96414346 | 2.0159361 |
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 59.7 | 12.5 | 27.8 | 2.147482 | 0.44964027 |
| Sternite | 7.3 | 35.3 | 57.4 | 0.1271777 | 0.6149826 |
| Tergite | 2 | 57.8 | 40.2 | 0.049751244 | 1.4378109 |
| Ventriculus | 10.7 | 39.9 | 49.4 | 0.2165992 | 0.8076923 |
| Thoracic muscle | |||||
| Fat body | 80.3 | 10.5 | 9.2 | 8.728261 | 1.1413044 |
| Malpighian tubules | 40 | 29.4 | 30.6 | 1.3071896 | 0.9607843 |
| Nerve chord | 22.2 | 44 | 33.7 | 0.6587537 | 1.305638 |
| Poison sac | |||||
| Sting | 46.6 | 53.4 | 0.87265915 | ||
| Heart | 13.6 | 44.2 | 42.2 | 0.3222749 | 1.0473933 |
| Hypopharyngeal gland | |||||
| Galea | 21.4 | 78.6 | 0.27226463 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.5 | 36.5 | 39.6 | 0.77020204 | 0.92171717 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSTYKLIYFNIPGLAEPIRFLLHQSGIKFEDKRIDIEEWPKIKSEMPLGQVPILEIDGKV YYQSKAISRLIAKRNNFYGSNDEEAFLVDATVETIDDLRQPITQHYWEKDHAFKAKLKIN VDTKVPLLLNKLEEQVKKNKGYFVNGKLTWADLFYAAIEESLTDMLGYDLNKDHPELKKL SEKIKSLPNIKTYLKNRPKSMVIP |
 Top
| |