| Protein: 58585132 NP_001011592.1 tetraspanin 6 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 45.1 | 54.9 | 0.8214936 | ||
| Scape | 46.5 | 25.3 | 28.2 | 1.6489362 | 0.8971631 |
| Brain | |||||
| Crop | 69.8 | 30.2 | 2.3112583 | ||
| Eye | |||||
| Intestine | 52.5 | 25.7 | 21.8 | 2.4082568 | 1.178899 |
| Leg, front | 25.5 | 45 | 29.5 | 0.86440676 | 1.5254238 |
| Leg, middle | 40.2 | 27.5 | 32.3 | 1.244582 | 0.85139316 |
| Leg, rear | 32.2 | 36.2 | 31.6 | 1.0189873 | 1.1455696 |
| Mandibular gland | 6.8 | 93.2 | 0.072961375 | ||
| Rectum | 71.1 | 28.9 | 2.4602077 | ||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 40.3 | 12.7 | 46.9 | 0.85927504 | 0.2707889 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 59.4 | 8.2 | 32.4 | 1.8333334 | 0.25308642 |
| Malpighian tubules | 8.1* | 70.1 | 21.8 | 0.37155962 | 3.2155964 |
| Nerve chord | 36.8 | 63.2 | 0.5822785 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 5.8 | 61.5 | 32.7 | 0.17737003 | 1.880734 |
| Hypopharyngeal gland | 17.5 | 82.5 | 0.21212122 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.6 | 33 | 42 | 0.9190476 | 0.78571427 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSCGMGMIKYLLFIFNFVFAVCGLGILTLGVLIHLQILGVSKQIETGLAFPSITLIVLGS IIFVISFFGCCGAIRESHCMTITFASFLLFILLVQIAVAVYAFIVVKNDDNFRNISEKYQ EIFNGYFLNSESKDFIDFIQKNLQCCGVHSLSDYNDKPIPASCCNSPENNTCSISNSYTN GCVEALKDTVKLAGTVFGSVAIAIAIVELIGIICALCLANSIKNAERRGYRV |
 Top
| |