| Protein: 110748820 XP_001120026.1 PREDICTED: 40S ribosomal protein S17 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 44.9 | 33 | 22.1 | 2.0316741 | 1.4932127 |
| Brain | |||||
| Crop | 16.4 | 46.5 | 37.1 | 0.44204852 | 1.2533693 |
| Eye | |||||
| Intestine | 56.7 | 43.3 | 1.3094689 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 38.9 | 14 | 47.1 | 0.82590234 | 0.29723993 |
| Sternite | 69.8 | 30.2 | 2.3112583 | ||
| Tergite | 40.7 | 42.2 | 17.1 | 2.380117 | 2.4678361 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 29 | 42.9 | 28.1 | 1.0320284 | 1.5266904 |
| Malpighian tubules | 40.7 | 27.2 | 32.1 | 1.2679127 | 0.847352 |
| Nerve chord | 44.7 | 9.9 | 45.4 | 0.9845815 | 0.21806167 |
| Poison sac | |||||
| Sting | 57 | 43 | 1.3255814 | ||
| Heart | 19.5 | 40.5 | 39.9 | 0.48872182 | 1.0150375 |
| Hypopharyngeal gland | 3.8 | 96.2 | 0.03950104 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.4 | 37 | 40.1 | 0.8578554 | 0.92269325 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSRVRTKTVKKAAKLIIEKYYTRLTMDFHTNKRICEEIAIIPSKSLRNKIAGFVTHLMKR LRHSQVRGISIKLQEEERERRDNYVPEVSALEHDIIEVDPETKEMLQMLGFNNIPGLQLT QSQLPPYSRRS |
 Top
| |