![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 66549073 XP_624173.1 PREDICTED: 6-phosphogluconolactonase-like |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 21.8 | 78.2 | 0.27877238 | ||
| Scape | 30.9 | 21.5 | 47.6 | 0.64915967 | 0.45168066 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 73.6* | 26.4 | 2.7878788 | ||
| Leg, front | 33.2 | 38.3 | 28.5 | 1.1649122 | 1.3438597 |
| Leg, middle | 51.9 | 48.1 | 1.079002 | ||
| Leg, rear | 71.4 | 28.6 | 2.4965036 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 59.5 | 4.7* | 35.8 | 1.6620111 | 0.13128492 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 11.1 | 49.3 | 39.6 | 0.28030303 | 1.2449495 |
| Malpighian tubules | 29.2 | 30 | 40.7 | 0.7174447 | 0.7371007 |
| Nerve chord | 19.9 | 41.7 | 38.4 | 0.5182292 | 1.0859375 |
| Poison sac | |||||
| Sting | |||||
| Heart | 3.8 | 53.5 | 42.7 | 0.088992976 | 1.2529274 |
| Hypopharyngeal gland | 28.9 | 71.1 | 0.40646976 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.2 | 39.3 | 43.8 | 0.7123288 | 0.89726025 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKKILVEPRDGSVVSCLSNILQTSAEEAFASSDTFKVGLSGGSLILLLAQSLPNIKTDWS RWNFFFCDERVVPFDSNDSTYGEYKSNLIGKIPITEDQFIKINPDLSAEDAAKDYIKKMS VFFPPDRVPCFDVLLLGLGPDGHICSLFPGHKLLNEASLWVCPINDSPKPPSSRITFTLP VINNAKKCIFAVTGSSKAEIIKRILQDKENLPAARVQPHNGELYWILDEAAAKFLGTA |
|
| |