| Protein: 110762229 XP_001122115.1 PREDICTED: trypsin-1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | 1.5* | 74.6* | 23.9 | 0.06276151 | 3.1213388 |
| Eye | |||||
| Intestine | 89.4* | 3.6 | 6.9 | 12.956522 | 0.5217391 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | 80.8* | 0.9 | 18.3 | 4.4153004 | 0.04918033 |
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | 27.1 | 72.9 | 0.3717421 | ||
| Ventriculus | 62.1* | 32.7* | 5.2 | 11.942307 | 6.2884617 |
| Thoracic muscle | |||||
| Fat body | 98.1* | 1.9 | 51.63158 | ||
| Malpighian tubules | 38.7 | 11.7* | 49.6 | 0.7802419 | 0.2358871 |
| Nerve chord | 2.8* | 59.5 | 37.6 | 0.07446808 | 1.5824468 |
| Poison sac | |||||
| Sting | 18.3 | 81.7 | 0.2239902 | ||
| Heart | 18.7 | 33.9 | 47.4 | 0.39451477 | 0.7151899 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 46.6 | 29.4 | 34.6 | 1.3468208 | 0.849711 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLVKCLLATILVIQACLAKSLEPRITDGVPAARGEFPYQVSVQWGIPPLTQYSHSCGGSI LNERYVLTAGHCIMKVGKSRVIAGKYELDKTESSQQVVDVAKSIVHKGYKGGVAQHDIAL LVLSSPLKFNNLVQPITLPKQGEKQTGQAVLSGWGSISKTAKPTLPNILQKANVPILDNA ECLKELTSQHVVGTQPELFDTQVCSGIAGKEVSACSGDSGGPLAQKVGTKSVQVGIVSWG MMPCGSSHMPSVYTRVASYVNWIHENMS |
 Top
| |