| Protein: 110760416 XP_001120771.1 PREDICTED: hypothetical protein LOC726268 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 7.9* | 51.3 | 40.8 | 0.19362745 | 1.257353 |
| Scape | |||||
| Brain | |||||
| Crop | 37.7 | 62.3 | 0.60513645 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 44.6 | 14.9 | 40.5 | 1.1012346 | 0.36790124 |
| Sternite | 20 | 80 | 0.25 | ||
| Tergite | 38.7 | 16.8 | 44.5 | 0.86966294 | 0.3775281 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | 39.2 | 60.8 | 0.6447368 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 77.5* | 22.5 | 3.4444444 | ||
| Hypopharyngeal gland | |||||
| Galea | 87.6* | 12.4 | 7.064516 | ||
| Glossa | 56.3 | 43.7 | 1.2883295 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 41.6 | 40.7 | 45.3 | 0.9183223 | 0.8984547 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSSVSSWILVVVGLIVSIQSGSALQCWDCASNTNPLCGDPMNVTDHHGIFHVKTCESGIY DTSRKICRKIVKRENGERVVIRQCSTPNVDEADIVDGPCSATAISTRNLIECYICSTDLC NSAMGVSVTRSLFMVTLTIIGYCYVQSKYIAL |
 Top
| |