| Protein: 110750754 XP_001119884.1 PREDICTED: protein lethal(2)essential for life-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 22.6 | 33.4 | 44 | 0.51363635 | 0.7590909 |
| Scape | 45 | 17.2 | 37.8 | 1.1904762 | 0.45502645 |
| Brain | 47.1 | 52.9 | 0.89035916 | ||
| Crop | 7.8* | 56.3 | 35.9 | 0.2172702 | 1.5682452 |
| Eye | 83.5* | 7.5 | 9 | 9.277778 | 0.8333333 |
| Intestine | 66.4 | 33.6 | 1.9761904 | ||
| Leg, front | 25.5 | 18.2* | 56.3 | 0.45293072 | 0.3232682 |
| Leg, middle | 8.1* | 91.9 | 0.08813928 | ||
| Leg, rear | 63.8 | 36.2 | 1.7624309 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 76.7 | 1.3 | 22 | 3.4863636 | 0.05909091 |
| Salivary gland, thoracic | 75.3* | 12.4 | 12.3 | 6.121951 | 1.0081301 |
| Sternite | 50.8 | 37.4 | 11.8 | 4.3050847 | 3.1694915 |
| Tergite | 69.5 | 30.5 | 2.2786884 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 36.8 | 36.8 | 26.4 | 1.3939394 | 1.3939394 |
| Malpighian tubules | 48.1 | 23.1 | 28.8 | 1.6701388 | 0.8020833 |
| Nerve chord | 34 | 18.8 | 47.2 | 0.720339 | 0.3983051 |
| Poison sac | |||||
| Sting | 36.9 | 63.1 | 0.58478606 | ||
| Heart | 35.7 | 36.5 | 27.9 | 1.2795699 | 1.3082438 |
| Hypopharyngeal gland | 52.4 | 47.6 | 1.1008403 | ||
| Galea | 73.8* | 26.2 | 2.816794 | ||
| Glossa | 34.4 | 45.5 | 20.1 | 1.7114428 | 2.2636817 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 46.6 | 32.2 | 36.3 | 1.2837466 | 0.88705236 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSLVPLLFSDWWETLDRPHRLLDQNFGLGLYPEQLLSPSRLELCLQPRRGNVYISRPNWA ELFRGDRGSSTVQADKDKFQVVLDVQQFEPHEIDVKVVDKFVVVTAKHEEKRDEHGWISR QFVRKYLIPEQCDLEQVSSKLSSDGVLTITAPRKDQGNVENERVIKIEQTGKPAIQTKPP KQQQNQNEENEEKK |
 Top
| |