![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 66499293 XP_623552.1 PREDICTED: glucose-6-phosphate isomerase-like |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 27.7 | 46.3 | 26 | 1.0653846 | 1.7807692 |
| Scape | 20.5 | 34.7 | 44.8 | 0.4575893 | 0.7745536 |
| Brain | 28 | 32.1 | 39.9 | 0.7017544 | 0.80451125 |
| Crop | 44.6 | 18.4 | 37.1 | 1.2021563 | 0.49595687 |
| Eye | 20.9 | 45.2 | 33.9 | 0.61651915 | 1.3333334 |
| Intestine | 39.3 | 23.9 | 36.8 | 1.0679348 | 0.6494565 |
| Leg, front | 29.1 | 34 | 36.9 | 0.7886179 | 0.9214092 |
| Leg, middle | 27.6 | 34.7 | 37.6 | 0.7340425 | 0.92287236 |
| Leg, rear | 39.1 | 30.2 | 30.7 | 1.2736156 | 0.9837133 |
| Mandibular gland | 65 | 35 | 1.8571428 | ||
| Rectum | 38.3 | 34.1 | 27.6 | 1.3876811 | 1.2355072 |
| Salivary gland, cerebral | 25.9 | 7.8 | 66.3 | 0.39064857 | 0.11764706 |
| Salivary gland, thoracic | 38.3 | 29.1 | 32.6 | 1.1748466 | 0.892638 |
| Sternite | 28.6 | 31.8 | 39.6 | 0.7222222 | 0.8030303 |
| Tergite | 26.5 | 42.9 | 30.6 | 0.86601305 | 1.4019607 |
| Ventriculus | 3.1 | 59.8 | 37.1 | 0.08355795 | 1.6118598 |
| Thoracic muscle | 66.3 | 33.7 | 1.9673591 | ||
| Fat body | 50.8 | 23.6 | 25.6 | 1.984375 | 0.921875 |
| Malpighian tubules | 25.2 | 51.8 | 23 | 1.0956522 | 2.252174 |
| Nerve chord | 9.6 | 66.1 | 24.4 | 0.39344263 | 2.7090163 |
| Poison sac | |||||
| Sting | 43 | 57 | 0.75438595 | ||
| Heart | 23.4 | 32.1 | 44.5 | 0.5258427 | 0.7213483 |
| Hypopharyngeal gland | 42.3 | 57.7 | 0.73310226 | ||
| Galea | 17.9 | 50.3 | 31.8 | 0.5628931 | 1.581761 |
| Glossa | 15.4 | 64.7 | 20 | 0.77 | 3.235 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.9 | 38.2 | 36.4 | 0.8489011 | 1.0494505 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKPKLQLTSEVAWTKLQQYFSTNGSKIKIYDLFQQDPKRFENFSLEISTPEDGPILLDYS KNRLTKEALQLLLELAKAREVEAARDAMFKGEKINFTENRAVLHIALRNRLNKPILVDNK DVMPDVNAVLNHMKQFTNEVLSKQWKGFTGKPIEDVVNIGIGGSDLGPLMVTEALKAFHI GPRVHFVSNIDGTHIAETLKKLNPETTLFIIASKTFTTQETITNAISAKIWLLETLKNPT AVAQHFVALSTNNQKVKEFGIDEKNMFGFWDWVGGRYSLWSAIGLSICLSIGFENFEKLL SGAHFMDQHFCTAPLEKNASILLALLGIWYHNFYKTETHALLPYDQYLHRFAAYFQQGDM ESNGKYVTREGKVVNYTTGPIVWGEPGTNGQHAFYQLLHQGTRLVPCDFIIPIQSHNKVQ GNLHHKILLANCFAQTEALMKGKNENEARTELQKAGVNPEQINLLLPHKVFEGNRPTNTI LLKKITPFILGALIAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKVIEPELESTQPVTN HDSSTNGLIAFAKKYIS |
|
| |