| Protein: 328778846 XP_001119861.2 PREDICTED: actin-related protein 2/3 complex subunit 5 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 48.1 | 51.9 | 0.92678225 | ||
| Scape | 64.1 | 35.9 | 1.7855153 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 60.2 | 39.8 | 1.5125629 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 75.1 | 24.9 | 3.0160642 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 38.8 | 28 | 33.2 | 1.1686747 | 0.8433735 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 33.8 | 33.6 | 32.6 | 1.0368098 | 1.0306748 |
| Nerve chord | 41.4 | 58.6 | 0.7064846 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 34.3 | 38.4 | 27.3 | 1.2564102 | 1.4065934 |
| Hypopharyngeal gland | 50.8 | 49.2 | 1.0325203 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 49 | 42.1 | 39.3 | 1.2468194 | 1.0712469 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSRNDGKKDSSASTFRKIDVDQYSDNNFREEDADGGIGGPTGPDENEILTLLSQYPFYNF QGKNAEALISVLRSAPLGCKNQQVKDNARNLTLKVLLSIKSTQIDDCLTQLDRDMLDVLM KYIYRGFEIPTEGSSSHLLTWHEKVYNISGVGSIVRAFADSKRA |
 Top
| |