| Protein: 48096769 XP_392518.1 PREDICTED: proteasome subunit alpha type-3 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 44.1 | 25 | 30.9 | 1.4271845 | 0.80906147 |
| Scape | 33.8 | 29 | 37.2 | 0.9086022 | 0.77956986 |
| Brain | 49.5 | 50.5 | 0.980198 | ||
| Crop | 35.8 | 27.9 | 36.3 | 0.9862259 | 0.76859504 |
| Eye | 39.4 | 32.4 | 28.2 | 1.3971632 | 1.1489362 |
| Intestine | 24.5 | 44.3 | 31.1 | 0.78778136 | 1.4244373 |
| Leg, front | 28.5 | 41.5 | 29.9 | 0.9531773 | 1.3879598 |
| Leg, middle | 33.9 | 32.7 | 33.4 | 1.0149701 | 0.97904193 |
| Leg, rear | 42.7 | 26.4 | 30.9 | 1.3818771 | 0.8543689 |
| Mandibular gland | 4.4 | 95.6 | 0.046025105 | ||
| Rectum | 21.1 | 52.3 | 26.7 | 0.79026216 | 1.9588015 |
| Salivary gland, cerebral | 58.5 | 12.2 | 29.4 | 1.9897959 | 0.414966 |
| Salivary gland, thoracic | 35.9 | 31.9 | 32.3 | 1.1114551 | 0.9876161 |
| Sternite | 27.6 | 40.6 | 31.8 | 0.8679245 | 1.2767296 |
| Tergite | 28 | 44.7 | 27.3 | 1.0256411 | 1.6373626 |
| Ventriculus | 51.3 | 48.7 | 1.0533881 | ||
| Thoracic muscle | |||||
| Fat body | 20.2 | 40.3 | 39.5 | 0.5113924 | 1.0202532 |
| Malpighian tubules | 24.7 | 35 | 40.3 | 0.61290324 | 0.86848634 |
| Nerve chord | 34.2 | 25.8 | 40 | 0.855 | 0.645 |
| Poison sac | |||||
| Sting | 56.6 | 43.4 | 1.3041475 | ||
| Heart | 26 | 41.7 | 32.3 | 0.8049536 | 1.2910217 |
| Hypopharyngeal gland | 59.8 | 40.2 | 1.4875622 | ||
| Galea | 43.8 | 56.2 | 0.77935946 | ||
| Glossa | 24.6 | 24.8 | 50.6 | 0.486166 | 0.49011856 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.9 | 37.8 | 39.3 | 0.78625953 | 0.96183205 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSSIGTGYDLSASQFSPDGRVFQVEYAQKAVENGGTVIGLRGKDGIVFAVEKIVTSKLYE AGTNKRIFNIDQHVGMAVSGLISDARQIVEIARSEASSYKSQYGIGIPLKYLNERVSMYM HAYTLYSAVRPYGCSVILGAYEHDGPAMYMIDPSGVSYGYYGCAVGKAKQSAKTEIEKLK LSEMTCNELVKEAARIIYLVHDELKDKQFELEMSWVGKHTNGKHERIPANVKAEAEAKAK QAMAEDSDSDTEDM |
 Top
| |