Home List proteins by tissue Protein search Downloads Links
Protein: 66523390 XP_392776.2 PREDICTED: glutamate dehydrogenase mitochondrial isoform 1
Distribution (mouse over here
Sample of a protein distribution map.
for a definition map of the organs displayed below):
Drone Queen Worker











































































































































































































































The above diagram is generated from the following data:
(Organs are coloured according to percent relative expression - 100% = black, 0% = white)

Tissues Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Flagellum 4* 33.4 62.6 0.063897766 0.5335463
Scape 34.6 30.4 35 0.9885714 0.8685714
Brain 66.4 5.7 27.9 2.3799284 0.20430107
Crop 17.6 45.3 37.1 0.47439352 1.2210243
Eye 7.6 64.2 28.3 0.26855123 2.2685513
Intestine 41.2 25.6 33.2 1.2409638 0.7710843
Leg, front 27.6 6.2* 66.1 0.41754916 0.093797274
Leg, middle 43 4.6* 52.4 0.8206107 0.08778626
Leg, rear 58.4 9.3 32.3 1.8080496 0.2879257
Mandibular gland 90.4* 2 7.6 11.894737 0.2631579
Rectum 25.5 41.2 33.3 0.7657658 1.2372372
Salivary gland, cerebral 26.5 30.3 43.2 0.6134259 0.7013889
Salivary gland, thoracic 47.2 20.7 32.1 1.470405 0.6448598
Sternite 58.2* 36.5* 5.3 10.981133 6.8867927
Tergite 56.1 24.8 19.1 2.937173 1.2984294
Ventriculus 83.4 16.6 5.0240965
Thoracic muscle 6 69 25 0.24 2.76
Fat body 44.9 37.7 17.4 2.5804598 2.1666667
Malpighian tubules 63.3* 21.5 15.2 4.1644735 1.4144737
Nerve chord 36.1 23.7 40.2 0.89800996 0.5895522
Poison sac
Sting 42 58 0.7241379
Heart 41.9 24.2 33.9 1.2359883 0.7138643
Hypopharyngeal gland 90.1 9.9 9.10101
Galea 33.5 29.1 37.4 0.8957219 0.77807486
Glossa 21.7 23.1 55.2 0.39311594 0.41847825
An asterisk (*) on D or Q values denote a significance difference from W (p<0.05).
Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Whole Body Average 40.7 30.9 33 1.2333333 0.93636364
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their
whole body averages are significantly different (p<0.05) from each other.
Sequence: MFHVKQLTRSSIALKQVPSNDIIHNTLIRIVPAFQARGYADHQIPDHLKDIPNDPNPKFF
DMVEYFFHRACQIVEDKLVEDIGKRSRMTVEERKKKVKGILMLMERCDHILETSFPLRRD
SGDYEMITGYRAQHSTHRTPCKGGIRFSMDVSRDEVKALSALMTFKCACVDVPFGGAKAG
IKINPKLYSEHELEKITRRFTLELAKKGFIGPGVDVPAPDMGTGEREMSWIADTYAKTIG
HLDINAHACVTGKPINQGGIHGRISATGRGVFHGLENFINEANYMSMIGTTPGWGGKTFI
VQGFGNVGLHSMRYLHRAGAACIGVIEHDGAIYNAEGIDPKKLEDYRIENGTIVGFPGAK
PYEGENLMYEPCDIFIPAAIEKVINKDNASFIQAKIIAEAANGPTTPAADKILIDRNILV
IPDLYINAGGVTVSFFEWLKNLNHVSYGRLTFKYEKESNYHLLESVQESLERRFGRVGGR
IPVTPSEAFQKRISGASEKDIVHSGLDYTMERSARAIMKTAMKFNLGLDLRTAAYINSIE
KIFTTYSEAGLAF

Top