| Protein: 328781392 XP_001122538.2 PREDICTED: beta-hexosaminidase subunit beta-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 10.1 | 68.5* | 21.4 | 0.47196263 | 3.2009346 |
| Scape | 37.5 | 35.9 | 26.5 | 1.4150944 | 1.354717 |
| Brain | 28.3 | 49.7 | 22 | 1.2863636 | 2.259091 |
| Crop | 56.4 | 43.6 | 1.293578 | ||
| Eye | |||||
| Intestine | 29.6 | 35.7 | 34.7 | 0.8530259 | 1.0288185 |
| Leg, front | |||||
| Leg, middle | 65.1 | 34.9 | 1.8653295 | ||
| Leg, rear | 77.5 | 22.5 | 3.4444444 | ||
| Mandibular gland | 19.7 | 80.3 | 0.24533 | ||
| Rectum | 44 | 3 | 52.9 | 0.831758 | 0.056710776 |
| Salivary gland, cerebral | 89 | 11 | 8.090909 | ||
| Salivary gland, thoracic | 31.9 | 27.1 | 41.1 | 0.7761557 | 0.6593674 |
| Sternite | 12.5 | 33.9 | 53.6 | 0.23320895 | 0.6324627 |
| Tergite | 17.3 | 27.5 | 55.2 | 0.3134058 | 0.4981884 |
| Ventriculus | 77.1 | 22.9 | 3.3668122 | ||
| Thoracic muscle | |||||
| Fat body | 38.8 | 36.3 | 24.8 | 1.5645162 | 1.4637097 |
| Malpighian tubules | 24.6 | 26.1 | 49.2 | 0.5 | 0.5304878 |
| Nerve chord | 13.3 | 61.7 | 25.1 | 0.52988046 | 2.4581673 |
| Poison sac | |||||
| Sting | 55.3 | 44.7 | 1.2371365 | ||
| Heart | 32.8 | 33.2 | 34 | 0.9647059 | 0.9764706 |
| Hypopharyngeal gland | |||||
| Galea | 81.7* | 18.3 | 4.464481 | ||
| Glossa | 45.6 | 54.4 | 0.8382353 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39.5 | 41.1 | 36.8 | 1.0733696 | 1.1168479 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTTRWRRIVPSTVQHLFLEKASIDMRAGCLLSCLLIALAHGADSLNPDAGPWVQPTHGEP WPMPNHRHVTDKFYLLRASTFQLNVVGKTCDIVADAVERYKAIILAEARIAKISSQGHAR SQIRDNTTITDTLNTLNIHLREPCEKDGNHWPYLGMDESYKLNINETSTVDLYAKTVWGI LRGLETFSQLLIPTGDGSNLKIRCQSIVDFARLPHRGLLLDTSRHYLPIHDILLTLDAMS YNKMNVLHWHIVDDNSFPYQSSSYPNLSAKGAYHPSMVYTLNDIQQIVDYARLRGIRVMP EFDTPGHTRSWGLAYPELLTTCYDVKGKPNGKLGPMNPTNPALYEFLRNLFAEIVQVFPD QYVHLGGDEVPFDCWKSNPEINSYMKSRNMSSYNLLESEYIGRLLRITDSLEANTIVWQE VFENGVVMPNTTVVHVWTGLWAKKLEEATKAGHPVLLSACWYLDHIVNPRDWKKFYACDP LAFNKTVNSSHLMLGGEACMWGEFVDKNNVHPKIWPHASATAERLWTFVKQDDNKAAQRL EEHACRMNRRGIPAQPPNGPGFCVIVAFLLTPRGKEFNWFLSKGIEDQTRVI |
 Top
| |