| Protein: 66559310 XP_623106.1 PREDICTED: 60S acidic ribosomal protein P0 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 26.9* | 73.1 | 0.36798906 | ||
| Scape | 40.7 | 31.3 | 28 | 1.4535714 | 1.1178571 |
| Brain | |||||
| Crop | 19.3 | 39.9 | 40.8 | 0.4730392 | 0.97794116 |
| Eye | |||||
| Intestine | 15.3 | 49.4 | 35.4 | 0.43220338 | 1.3954803 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 67.7 | 32.3 | 2.0959752 | ||
| Mandibular gland | |||||
| Rectum | 49.7 | 50.3 | 0.98807156 | ||
| Salivary gland, cerebral | 53.1 | 9.1 | 37.8 | 1.4047619 | 0.24074075 |
| Salivary gland, thoracic | 34.8 | 27.4 | 37.8 | 0.9206349 | 0.7248677 |
| Sternite | 30.7 | 37.6 | 31.6 | 0.971519 | 1.1898735 |
| Tergite | 86.1 | 13.9 | 6.1942444 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 33.6 | 37.8 | 28.5 | 1.1789473 | 1.3263158 |
| Malpighian tubules | 35.2 | 21.9 | 42.9 | 0.82051283 | 0.5104895 |
| Nerve chord | 46.9 | 14.9 | 38.2 | 1.2277486 | 0.39005235 |
| Poison sac | |||||
| Sting | 43.4 | 56.6 | 0.7667844 | ||
| Heart | 15.9 | 46.5 | 37.6 | 0.42287233 | 1.2367021 |
| Hypopharyngeal gland | 14.8 | 85.2 | 0.17370892 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.1 | 37 | 41.9 | 0.8138425 | 0.8830549 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGREDKATWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNAVVLMGKNTM MRKAIRGHIERNAALEKLLPHIRGNVGFVFTRGDLIEVRDKLLENKVRAPARAGAIAPLS VIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNI SPFSYGLLVEQVYDSGTIFAPEILDIKPEDLCEKFMAGVANLAAVCLAIGYPTIASAPHS IANGFKNLLAIAAVTDIEFPEATTIKEYIKDPSKFAATVSVAAPVVSSTETPAAEKKEEK KEESESEDEDMGFGLFD |
 Top
| |