| Protein: 67010041 NP_001019868.1 major royal jelly protein 9 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 72.3* | 3.1* | 24.6 | 2.9390244 | 0.12601626 |
| Leg, front | 68.1 | 31.9 | 2.1347961 | ||
| Leg, middle | 68.6 | 31.4 | 2.1847134 | ||
| Leg, rear | 2.5* | 33.5 | 63.9 | 0.039123632 | 0.52425665 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | 85.1* | 14.9 | 5.7114096 | ||
| Poison sac | 20 | 80 | 0.25 | ||
| Sting | 38.9 | 61.1 | 0.63666123 | ||
| Heart | |||||
| Hypopharyngeal gland | 2.4* | 97.6 | 0.024590164 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 40 | 50.7 | 0.7889546 | ||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSFNIWWLILYFSIVCQAKAHYSLRDFKANIFQVKYQWKYFDYNFGSDEKRQAAIQSGEY NYKNNVPIDVDRWNGKTFVTILRNDGVPSSLNVISNKIGNGGPLLEPYPNWSWAKNQNCS GITSVYRIAIDEWDRLWVLDNGISGETSVCPSQIVVFDLKNSKLLKQVKIPHDIAINSTT GKRNVVTPIVQSFDYNNTWVYIADVEGYALIIYNNADDSFQRLTSSTFVYDPRYTKYTIN DESFSLQDGILGMALSHKTQNLYYSAMSSHNLNYVNTKQFTQGKFQANDIQYQGASDILW TQASAKAISETGALFFGLVSDTALGCWNENRPLKRRNIEIVAKNNDTLQFISGIKIIKQI SSNIYERQNNEYIWIVSNKYQKIANGDLNFNEVNFRILNAPVNQLIRYTRCENPKTNFFS IFL |
 Top
| |