![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 66517554 XP_393699.2 PREDICTED: reticulocalbin-2-like |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 53.6 | 46.4 | 1.1551725 | ||
| Scape | 19.8 | 51.9 | 28.3 | 0.69964665 | 1.8339223 |
| Brain | |||||
| Crop | 61.7 | 38.3 | 1.6109661 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 29.5 | 8.6 | 61.8 | 0.47734627 | 0.13915858 |
| Salivary gland, thoracic | 36.4 | 36.8 | 26.9 | 1.3531599 | 1.3680297 |
| Sternite | 35.6 | 41.6 | 22.8 | 1.5614035 | 1.8245614 |
| Tergite | 41.2 | 34.9 | 23.9 | 1.7238494 | 1.4602511 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 46.3 | 53.7 | 0.8621974 | ||
| Nerve chord | 39.9 | 15.2 | 44.9 | 0.8886414 | 0.33853006 |
| Poison sac | |||||
| Sting | 48.4 | 51.6 | 0.93798447 | ||
| Heart | 40.6 | 26.3 | 33.2 | 1.2228916 | 0.7921687 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | 14.7 | 35.7 | 49.6 | 0.29637095 | 0.7197581 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.5 | 36.3 | 40.1 | 0.8852868 | 0.9052369 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MDTRQMRVEILLFVIAIFGLFSFGNAASAHIHSHQHNKPGSNERTEDGAFSPRDMDHYAG GEHHQEFDHEAILGSVKEAEEFDKLPTQESKRRLGILLTKMDLNNDKFIERNELKAWILR SFSMLSAEESQDRLEDTDTDEDGKVSWNEILQDTYGTDPEDLAVDDKLISDDKQTFEAAD INKDGHLDKEEFKAYTHPEETPRMFPLLLKQALDDKDTDKDGFISFQEFIGNRAKAEDKE WLLIEKDKFDYEHDKNGDGRLDSDEILSWLVPSNEEIASDEVDHLFAASDDDHDNRLSFD EILDHHDAFVGSEATDYGDHLQDIGRFTDEL |
|
| |