| Protein: 328782084 XP_397188.3 PREDICTED: antithrombin-III |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 25.1 | 60.9* | 14 | 1.7928572 | 4.35 |
| Scape | 9.8 | 67.3* | 22.9 | 0.4279476 | 2.9388647 |
| Brain | |||||
| Crop | 66 | 34 | 1.9411764 | ||
| Eye | |||||
| Intestine | 65.8 | 34.2 | 1.9239767 | ||
| Leg, front | |||||
| Leg, middle | 23 | 45.8 | 31.2 | 0.73717946 | 1.4679487 |
| Leg, rear | 24.5 | 30.1 | 45.4 | 0.5396476 | 0.6629956 |
| Mandibular gland | 23.3 | 76.7 | 0.30378097 | ||
| Rectum | |||||
| Salivary gland, cerebral | 49.8 | 27.8 | 22.3 | 2.2331839 | 1.2466367 |
| Salivary gland, thoracic | 38.3 | 25.6 | 36.2 | 1.058011 | 0.70718235 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 37.5 | 28.1 | 34.4 | 1.0901163 | 0.81686044 |
| Malpighian tubules | 53.8* | 24.8 | 21.4 | 2.5140188 | 1.1588784 |
| Nerve chord | 25.1 | 50.3 | 24.6 | 1.0203252 | 2.0447154 |
| Poison sac | 91.3* | 8.7 | 10.494253 | ||
| Sting | 17 | 83 | 0.20481928 | ||
| Heart | 12.5 | 42.8 | 44.7 | 0.27964205 | 0.9574944 |
| Hypopharyngeal gland | 16 | 84 | 0.1904762 | ||
| Galea | 22.1 | 31.2 | 46.6 | 0.47424892 | 0.6695279 |
| Glossa | 26.3 | 32 | 41.7 | 0.63069546 | 0.7673861 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 28.5 | 42.5 | 39.2 | 0.7270408 | 1.0841837 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKDMFLSSLFNDFYYNSLVIRSLFLLALRDSPSIFVNLNIVKITKNLGKKEIGKIEYKKD YTEDLSLKEEYSNSHKLTSVSSRENEIISVLSVLLVLRGISAQCLTGNDSPSMMGAGSKK AIIDSKFRFALETLKKISLFESQDNIIYSPYSIHQAVTLAYFGSRGTTEEALKRALQLPA DISKVDVQRYYSFENTLKQQINGQNDVSSNYEFNSANRLWISDKKKVRECILSLFGNQLE MIDFKTNPNAVRDQINNWVSNMTKGHIRDLLPPNSITTDTDLVLANAVYFKGLWKSRFNP NNSKKDIFYSSKSQHSMVKYMRQQGNFNHVISEILGAHVLELPYKGNEISMFILLPPFVT KISNDSAQNGERDSIYHLIERLSTEAGYTEIRDLLTSDSLPQPVEIILPRFEVEKELQIT TLLDAIGAGELVMPDVANLKGFVEDGEESVHLGAAVHRARIEVTEEGTTAAAATAIYTFR SGRPLVPTVFNANHPFVYFIYEKPKRTILFAGIYRNPNTQKNAAETA |
 Top
| |