| Protein: 328792314 XP_003251707.1 PREDICTED: mitochondrial import inner membrane translocase subunit Tim10 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 20.6 | 48.6 | 30.8 | 0.66883117 | 1.5779221 |
| Scape | 18.8* | 13.1 | 68.1 | 0.2760646 | 0.19236417 |
| Brain | 40.4 | 59.6 | 0.67785233 | ||
| Crop | |||||
| Eye | |||||
| Intestine | 4.8* | 36.3 | 58.9 | 0.081494056 | 0.6162988 |
| Leg, front | 63 | 37 | 1.7027028 | ||
| Leg, middle | 63.5 | 36.5 | 1.7397261 | ||
| Leg, rear | |||||
| Mandibular gland | 89.8* | 10.2 | 8.803922 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 59.2 | 8.4 | 32.4 | 1.8271605 | 0.25925925 |
| Sternite | 21.8 | 36.3 | 41.9 | 0.5202864 | 0.86634845 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 12.3 | 72.6 | 15.2 | 0.80921054 | 4.7763157 |
| Fat body | |||||
| Malpighian tubules | 36.6 | 33.4 | 29.9 | 1.2240803 | 1.1170568 |
| Nerve chord | 66.7 | 5.2 | 28.1 | 2.3736656 | 0.18505338 |
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.2 | 42.7 | 37.4 | 0.8342246 | 1.1417112 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAGLPQFSEEQLKLVRDIEIEMMTDMFHRMTAACHRKCIPPKYTSSELSKGESVCLDRCI AKYLDVQERIGKKLQQISLQEGKIVEQPKLS |
 Top
| |