| Protein: 328791828 XP_393400.3 PREDICTED: small glutamine-rich tetratricopeptide repeat-containing protein alpha |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 49.4 | 23.2 | 27.4 | 1.8029197 | 0.84671533 |
| Scape | 29.4 | 26.7 | 44 | 0.66818184 | 0.6068182 |
| Brain | |||||
| Crop | 38 | 62 | 0.61290324 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | 59.2 | 40.8 | 1.4509804 | ||
| Leg, middle | 58.1 | 41.9 | 1.3866348 | ||
| Leg, rear | 53.2 | 46.8 | 1.1367521 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 65.5 | 34.5 | 1.8985507 | ||
| Salivary gland, thoracic | 36.1 | 31.1 | 32.8 | 1.1006098 | 0.9481707 |
| Sternite | 57.6 | 42.4 | 1.3584906 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 35.2 | 39.4 | 25.3 | 1.3913044 | 1.5573123 |
| Nerve chord | 43.5 | 29.6 | 27 | 1.6111112 | 1.0962963 |
| Poison sac | |||||
| Sting | |||||
| Heart | 55.7 | 44.3 | 1.2573364 | ||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 44.6 | 41.9 | 39.1 | 1.1406649 | 1.0716113 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTRIRNFPLLNNINSFKAVMAVKGLIAAIVQFLTQQLEEGDITADSRESLEVAIQCLESA YNVQASDTPTNFNLYEVYKSSVENAKPYLAPEATPEAKAEAERLKNEGNTLMKAEKHHEA LANYTKAIQLDGRNAVYYCNRAAAYSKIGNYQQAINDCHTALSIDPSYSKAYGRLGLAYS SLQRHKEAKESYQKALEMEPDNESYKNNLQVAEEKLAQPSMSNMGLGGSALPGMDLSSLL SNPALMNMARQMLSNPALQNMVSNFMSGQVEQGGHMDALIEAGQHFARQLQNANPELIES LRRQMGGNPNDPDPPQQN |
 Top
| |