| Protein: 66530247 XP_397478.2 PREDICTED: thioredoxin-related transmembrane protein 1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 64 | 36 | 1.7777778 | ||
| Scape | 40.6 | 30.7 | 28.7 | 1.4146341 | 1.0696864 |
| Brain | |||||
| Crop | 33.9 | 32.6 | 33.5 | 1.0119402 | 0.97313434 |
| Eye | |||||
| Intestine | 15.4 | 51.6 | 33 | 0.46666667 | 1.5636364 |
| Leg, front | 36 | 35.7 | 28.2 | 1.2765957 | 1.2659575 |
| Leg, middle | 40.9 | 33.3 | 25.9 | 1.5791506 | 1.2857143 |
| Leg, rear | 36.5 | 38.4 | 25 | 1.46 | 1.536 |
| Mandibular gland | 26.2 | 73.8 | 0.35501355 | ||
| Rectum | 25.9 | 74.1 | 0.34952766 | ||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 33.8 | 30.1 | 36.1 | 0.9362881 | 0.833795 |
| Sternite | 44 | 18.5 | 37.5 | 1.1733333 | 0.49333334 |
| Tergite | 34.6 | 65.4 | 0.52905196 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 48.1 | 15.8 | 36.1 | 1.33241 | 0.43767312 |
| Malpighian tubules | 57.3 | 42.7 | 1.3419204 | ||
| Nerve chord | 29.3 | 40.9 | 29.8 | 0.9832215 | 1.3724833 |
| Poison sac | |||||
| Sting | |||||
| Heart | 17.4 | 39 | 43.6 | 0.39908257 | 0.8944954 |
| Hypopharyngeal gland | 41.9 | 58.1 | 0.7211704 | ||
| Galea | 35.3 | 28.6 | 36.1 | 0.97783935 | 0.7922438 |
| Glossa | 32.6 | 33.3 | 34.1 | 0.9560117 | 0.9765396 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.5 | 34.6 | 40.9 | 0.86797065 | 0.84596574 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSCTKFRFLFYITYSCLFLNLVNANIQTSSKNTFAEQLTEENWDRILIGEWMVEFYAPWC PACKALEPIWEHLASQKKNLNINVAKVDVTDSPGLSGRFMVTALPTIYHVKDGIFRQYKS PRDKDSLIEFVSEKTWEKIEPIPGWKSPTSIQMSLISQFFKMSQVLRGIHNKLMEDFGLP TWGSYLIFAIATIVLGAILGLFIVCLIDFIYPPKPVVLQDKKKQKEGSGGFMQEKSIQDE EIVKHVKDDLVDEESEQEGSETEEKEKDVNKDSKTEPSSPNVRKRKPRKAD |
 Top
| |