| Protein: 328785044 XP_624330.3 PREDICTED: prohibitin-2-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 31.1 | 30.5 | 38.5 | 0.8077922 | 0.7922078 |
| Scape | 37.1 | 30.2 | 32.7 | 1.1345565 | 0.9235474 |
| Brain | 22.4 | 36.3 | 41.3 | 0.5423729 | 0.8789346 |
| Crop | 31.4 | 34.8 | 33.8 | 0.92899406 | 1.0295858 |
| Eye | 57.5 | 11 | 31.4 | 1.8312101 | 0.35031846 |
| Intestine | 28.7 | 29.1 | 42.3 | 0.678487 | 0.6879433 |
| Leg, front | 31.8 | 36.2 | 31.9 | 0.9968652 | 1.1347963 |
| Leg, middle | 32.7 | 39.2 | 28.1 | 1.163701 | 1.3950177 |
| Leg, rear | 27.4 | 40.5 | 32.1 | 0.85358256 | 1.2616823 |
| Mandibular gland | 67.2 | 32.8 | 2.0487804 | ||
| Rectum | 26.2 | 47.5 | 26.3 | 0.9961977 | 1.8060837 |
| Salivary gland, cerebral | 42.1 | 42.7 | 15.1 | 2.7880795 | 2.8278146 |
| Salivary gland, thoracic | 29 | 40 | 31.1 | 0.93247586 | 1.2861736 |
| Sternite | 29.9 | 37.5 | 32.6 | 0.9171779 | 1.1503067 |
| Tergite | 23.5 | 39 | 37.5 | 0.62666667 | 1.04 |
| Ventriculus | 8 | 35.9 | 56.1 | 0.1426025 | 0.6399287 |
| Thoracic muscle | 17.6 | 59.7 | 22.7 | 0.7753304 | 2.629956 |
| Fat body | 21.6 | 37.9 | 40.5 | 0.53333336 | 0.93580246 |
| Malpighian tubules | 28.4 | 30.9 | 40.7 | 0.6977887 | 0.75921375 |
| Nerve chord | 25.8 | 30.7 | 43.5 | 0.59310347 | 0.7057471 |
| Poison sac | 49 | 51 | 0.9607843 | ||
| Sting | 56 | 44 | 1.2727273 | ||
| Heart | 33 | 26.7 | 40.3 | 0.81885856 | 0.662531 |
| Hypopharyngeal gland | 73.4 | 26.6 | 2.7593985 | ||
| Galea | 43.5 | 31.7 | 24.9 | 1.7469879 | 1.2730924 |
| Glossa | 42.9 | 30.1 | 26.9 | 1.5947956 | 1.1189591 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.1 | 38.3 | 34.8 | 0.92241377 | 1.1005747 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNEFKLPKTPNGVSVAATCLAAVGVTGYGVWKSMYTVEAGHRAIIFSRLGGIQQDILTEG LHFRIPWFHWPIIYDIRSRPRKLSSPTGSKDLQMVNISLRVLSRPDAQSLPTMYRQLGLD YDEKVLPSICNEVLKSVVAKFNASQLITQRQQVSNLVRKELTERARDFNIVLDDVSITEL SFGKEYTAAVESKQVAQQEAQRAAFFVEKAKQEKQQKIVQAEGEAEAAKMLGLALSQNPG YLKLRKIRAAQNISRTIANSPNRLYLSGNGLMLNIQDPSFDDSSDKLKSDKRMMSWENWN DTMQSAVKHLTSEQQTTVKINEKPLIKSSVPSSEEQISILLDSADDGAKMIVS |
 Top
| |