| Protein: 58585114 NP_001011587.1 60S ribosomal protein L32 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 54 | 46 | 1.173913 | ||
| Scape | 44 | 28.1 | 27.9 | 1.5770609 | 1.0071684 |
| Brain | |||||
| Crop | 25.5 | 38.9 | 35.6 | 0.71629214 | 1.0926967 |
| Eye | 11.7 | 88.3 | 0.13250282 | ||
| Intestine | 57.5 | 42.5 | 1.3529412 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 83.2 | 1.8 | 15 | 5.5466666 | 0.12 |
| Salivary gland, thoracic | 29.1 | 32.3 | 38.6 | 0.753886 | 0.8367876 |
| Sternite | 20.7 | 39 | 40.2 | 0.51492536 | 0.9701493 |
| Tergite | 81 | 19 | 4.263158 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 39.1 | 32.1 | 28.8 | 1.3576388 | 1.1145834 |
| Malpighian tubules | 32.5 | 27.7 | 39.8 | 0.8165829 | 0.6959799 |
| Nerve chord | 53.7 | 3.7* | 42.7 | 1.2576113 | 0.08665106 |
| Poison sac | 0* | 100 | 0 | ||
| Sting | 47.9 | 52.1 | 0.9193858 | ||
| Heart | 41.2 | 32.4 | 26.4 | 1.560606 | 1.2272727 |
| Hypopharyngeal gland | 24.3 | 75.7 | 0.32100397 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 42 | 30 | 44.9 | 0.93541205 | 0.66815144 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAIRPVYRPTIVKKRTKKFIRHQSDRYSKLKRNWRKPKGIDNRVRRRFKGQYLMPNIGYG SNKKTRHMLPTGFRKVLVHNVKELEVLMMQNRKFCAEIAHGGSSKKRKSIVERAQQLSIR VTYASARLRSQENE |
 Top
| |