| Protein: 66561608 XP_624349.1 PREDICTED: UDP-N-acetylhexosamine pyrophosphorylase |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 48.9 | 51.1 | 0.95694715 | ||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 43.1 | 20.7 | 36.2 | 1.1906078 | 0.5718232 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 10.1* | 89.9 | 0.11234705 | ||
| Thoracic muscle | |||||
| Fat body | 32.2 | 28.3 | 39.5 | 0.8151899 | 0.7164557 |
| Malpighian tubules | 16.6 | 48.8 | 34.6 | 0.47976878 | 1.4104047 |
| Nerve chord | 64.3* | 23.6 | 12.1 | 5.3140497 | 1.9504132 |
| Poison sac | |||||
| Sting | |||||
| Heart | 13 | 52.5 | 34.5 | 0.3768116 | 1.5217391 |
| Hypopharyngeal gland | 25.7 | 74.3 | 0.34589502 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.3 | 30 | 46.5 | 0.78064513 | 0.6451613 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MESLKKKLIECGQEHLLKFYDELSDKEKEELCQEISELNFMDVISYFDSAIYGSLNMNTL DDKVSPIPKENIASVKTTDKEQLKMYEELGLQEIANGQVAVLLMAGGQGTRLGVTYPKGM YNVGLPSGKTLFQLQAERILRLENMAKEKYGKDGEITWYILTSEATHDITVSFLHQHNYF NLKEKNCKAFKQDMLPCFTLDGKIILDKKYKISKAPDGNGGVYRALITQGILDDMTQRGI HSVHVHSVDNILIKVADPIFIGYCLSLQTDCGVKVIQKCSPNEPVGIVCKVNDIFKVVEY SEISKETAELYSNDGQLMYNAANICNHYFTVDFLYSIAKYHEKEIELHAAKKKIPYIDED GNRNEPKIPNGIKIEKFIFDVFKFAKHLTVWEGIREEDFSPLKNADSVGQDCPSTARNDV LKLHKKWLLNAGAISVSGDIEISPLLSYAGENLNHIKGQLLEGPCVLE |
 Top
| |