| Protein: 48097536 XP_391916.1 PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 28 | 35.4 | 36.7 | 0.7629428 | 0.9645777 |
| Scape | 42.1 | 25.1 | 32.8 | 1.2835366 | 0.7652439 |
| Brain | |||||
| Crop | 52.9 | 47.1 | 1.1231422 | ||
| Eye | 15.8 | 35.7 | 48.5 | 0.3257732 | 0.7360825 |
| Intestine | 41.5 | 58.5 | 0.7094017 | ||
| Leg, front | 7.2* | 42 | 50.8 | 0.14173229 | 0.8267717 |
| Leg, middle | 23.3 | 38.1 | 38.7 | 0.6020672 | 0.9844961 |
| Leg, rear | 10.4 | 41.1 | 48.5 | 0.21443298 | 0.84742266 |
| Mandibular gland | 53.4 | 46.6 | 1.1459228 | ||
| Rectum | 63.4 | 3.4 | 33.2 | 1.9096385 | 0.10240964 |
| Salivary gland, cerebral | 11.7 | 24.5 | 63.8 | 0.18338558 | 0.38401255 |
| Salivary gland, thoracic | 25.4 | 50 | 24.6 | 1.0325203 | 2.0325203 |
| Sternite | 39.4 | 20.5 | 40.1 | 0.98254365 | 0.51122195 |
| Tergite | 37 | 11 | 52 | 0.71153843 | 0.21153846 |
| Ventriculus | 30.4 | 19.9 | 49.7 | 0.61167 | 0.40040243 |
| Thoracic muscle | 22.4 | 58.6 | 19.1 | 1.1727749 | 3.0680628 |
| Fat body | 43.4 | 37 | 19.6 | 2.2142856 | 1.8877552 |
| Malpighian tubules | 38.9 | 28.4 | 32.7 | 1.1896025 | 0.86850154 |
| Nerve chord | 22.9 | 41 | 36 | 0.63611114 | 1.1388888 |
| Poison sac | |||||
| Sting | 17.3 | 82.7 | 0.20918985 | ||
| Heart | 43.2 | 20.2 | 36.6 | 1.1803279 | 0.55191255 |
| Hypopharyngeal gland | 88.4 | 11.6 | 7.62069 | ||
| Galea | 31.1 | 36.6 | 32.3 | 0.9628483 | 1.133127 |
| Glossa | 45.9 | 15.8 | 38.3 | 1.1984334 | 0.41253263 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.8 | 33.3 | 40.8 | 0.8039216 | 0.8161765 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAGAIVRCFQVPRKQLGFLGSLLNSQQQRTFADAAPEGKKRGGPLADQDRIFTNLYGRHD WRLKGALKRGDWYKTKEIVEKGADWIINEIKVSGLRGRGGAGFPSGMKWSFMNKPSDGRP KYLVVNGDEGEPGTCKDREILRHDPHKLVEGCLIAGRAMGACAAYIYIRGEFYNEASNMQ VAIAEAYQAGLIGKNACGSGYDFDIFVQRGAGAYICGEETALIESIEGKQGKPRLKPPFP ADVGLFGCPTTVTNVETVAVAPTICRRGGAWFASFGRPRNHGTKLFNISGHVNNPCTVEE EMSIPLKELIERHAGGVIGGWDNLLGVIPGGSSTPVIPKSVCDTVLLDFDDLVRVQTSFG TAAVIVMNKQTDIIKAIARLISFYKHESCGQCTPCREGISWMYKIMRRFVQGQAEVHEID MLWELTKQIEMHTICALADGAAWPVQGLIRHFRPEIEARIAQHKQAISN |
 Top
| |