![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 110762813 XP_625009.2 PREDICTED: 60S ribosomal protein L22 isoform 1 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 52.4 | 47.6 | 1.1008403 | ||
| Scape | 35.9 | 33.4 | 30.8 | 1.1655844 | 1.0844156 |
| Brain | |||||
| Crop | 25 | 12.6* | 62.4 | 0.40064102 | 0.20192307 |
| Eye | |||||
| Intestine | 13.5 | 40 | 46.6 | 0.28969958 | 0.8583691 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 40 | 18.9 | 41.1 | 0.973236 | 0.459854 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 30.9 | 32.5 | 36.6 | 0.8442623 | 0.88797814 |
| Malpighian tubules | 40.6 | 21.7 | 37.7 | 1.0769231 | 0.5755968 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 53.8 | 46.2 | 1.1645021 | ||
| Heart | 20 | 48.7 | 31.3 | 0.63897765 | 1.5559106 |
| Hypopharyngeal gland | 20.2 | 79.8 | 0.25313282 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29.4 | 33.4 | 46 | 0.6391304 | 0.726087 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAPPTTKKSKGPAIKKQALRGKGQKKKVSLKFTIDCTHPAEDNIMDVANFEKYLHERIKV AGKTNNFGNSVTLERDKMKLSVNSDIDFSKRYLKYLTKKYLKKNKLRDWLRVVSKDKETY ELRYFQINSQEDDDEEDAE |
|
| |