| Protein: 66508573 XP_625149.1 PREDICTED: hydroxyacid oxidase 1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 72.3* | 27.7 | 2.6101084 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 97* | 3 | 32.333332 | ||
| Mandibular gland | |||||
| Rectum | 1.5* | 98.5 | 0.015228426 | ||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 5.3 | 44 | 50.7 | 0.10453649 | 0.8678501 |
| Malpighian tubules | 32.3 | 31.6 | 36.1 | 0.8947368 | 0.87534624 |
| Nerve chord | |||||
| Poison sac | 0.7 | 99.3 | 0.007049345 | ||
| Sting | |||||
| Heart | 2.8 | 27.8 | 69.4 | 0.04034582 | 0.40057638 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 41.9 | 21.1 | 54.9 | 0.7632058 | 0.38433516 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSQQMICIEDFQKYADQNLTPSVRDYYNSGAGEQFSLKLNTEAFKKYRIRPRFLRNVSKR DLSTTILGEKISMPLGIAPAAMQRMAHPEGECANVRAAQGAGTIYILSTISTSSIEEVAE AAPNAIKWFQLYIYKDRNVTINLVGRAERAGFKAIVLTVDAPLFGDRRADIRNKFSLPHH LRLGNFQGKLSTKINNAESGSGLSEYVMNLFDASLTWDDIKWLKSITKLPIILKGILTPE DAKLAIENGISAIIVSNHGARQVDSIPATIEALPEIVKAVNGKLEIYMDGGIRQGIDVFK ALALGAKMVFTARPLLWGLSYGGERGARAVLEVFRKEIDVAFALTGCATVNDVTKDMIQH ESYYSHL |
 Top
| |