| Protein: 328777541 XP_394896.3 PREDICTED: poly(ADP-ribose) glycohydrolase ARH3-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 51.5 | 48.5 | 1.0618557 | ||
| Scape | 24.8 | 35.8 | 39.4 | 0.6294416 | 0.9086294 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 27.1 | 47.9 | 25 | 1.084 | 1.916 |
| Leg, middle | 38.8 | 34.6 | 26.6 | 1.4586467 | 1.3007519 |
| Leg, rear | 38.7 | 39 | 22.4 | 1.7276785 | 1.7410715 |
| Mandibular gland | 46.3 | 53.7 | 0.8621974 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 38.2 | 24.2 | 37.7 | 1.0132626 | 0.64190984 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 5.9* | 94.1 | 0.06269926 | ||
| Fat body | |||||
| Malpighian tubules | 29 | 47.8 | 23.2 | 1.25 | 2.060345 |
| Nerve chord | 33.6 | 46.9 | 19.5 | 1.7230769 | 2.4051282 |
| Poison sac | |||||
| Sting | |||||
| Heart | 31.8 | 39.4 | 28.8 | 1.1041666 | 1.3680556 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.2 | 39.5 | 38.1 | 0.87139106 | 1.0367454 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAKMDLSLLKSKFRGSMLGALIGDCIGSPYDNEGQLTHGTKLVLQKSFDKLEGPIFKAPV MQFTDDSAMTYSVAKSLIEQKELDIIDIAKRFVKSYYEEPNRGYGMGVVTVFQKLRGNKF IDIESPAKEQFNGQGSWGNGGAMRIAPIALFSYQNYDKLLDTVRKVTQITHTHKIGIDGA ILQAIAIYQSLHLNPNEELNVINFIDDLINKMDQIEKDEEGLGLSEPQPYKIQLGIIKSL ISENNEGPHDEKVIQKLGNSVAALYSVPTAIFCFLRAQKPIIAIQTENPFRRAIQYAISL GGDTDTIGSMTGAIAGAFYGEEKISNNLLQHCEASEEFKVLGDKLFEISIAQ |
 Top
| |