![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 110750141 XP_396993.3 PREDICTED: solute carrier family 25 member 42-like isoform 1 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 33.3 | 66.7 | 0.49925038 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 39.2 | 60.8 | 0.6447368 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 6.8* | 73.7* | 19.5 | 0.34871796 | 3.7794871 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 16.1* | 32.5 | 51.4 | 0.31322956 | 0.6322957 |
| Nerve chord | 22.9 | 77.1 | 0.29701686 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | 80 | 20 | 4 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 19.8 | 56.4 | 49.3 | 0.4016227 | 1.1440163 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSVLSNSTKQVLQNTSSLSMEIQDDNTIMCNKKKQEKNIGSNGISNAQRVWTSLLSGAIA GALAKTTIAPLDRTKINFQISNQPFSAKAAIKFLIKTFRTEGLLSLWRGNSATMVRIVPY SAVQFTAHEQWKRILGVNGSEREKPGLNFLAGSLAGITSQGTTYPLDLMRARMAVTQKTK YKTLRQIFVRIYMEEGIAAYYRGFTATLLGVIPYAGCSFFTYDLLRNLLTVYTVAIPGFS TSLICGAIAGMVAQTSSYPLDIIRRRMQTSAMHGQHYHTIRSTIIKIYKEEGIMAFYKGL SMNWIKGPIAVGISFATHDTIRDTLRKIIICQNTSLKT |
|
| |