| Protein: 48095525 XP_392313.1 PREDICTED: tubulin beta-1 chain |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 11.7* | 43.2 | 45.1 | 0.2594235 | 0.9578714 |
| Scape | 30.5 | 31.3 | 38.2 | 0.7984293 | 0.8193717 |
| Brain | 41.5 | 8.5* | 50.1 | 0.82834333 | 0.16966067 |
| Crop | 29.1 | 41.8 | 29.1 | 1 | 1.4364262 |
| Eye | 46.9 | 29.8 | 23.3 | 2.0128756 | 1.27897 |
| Intestine | 22.8 | 55 | 22.3 | 1.0224215 | 2.4663677 |
| Leg, front | 40.6 | 12.6* | 46.8 | 0.86752135 | 0.26923078 |
| Leg, middle | 43.4 | 24.9 | 31.7 | 1.3690852 | 0.78548896 |
| Leg, rear | 44.9 | 47.8* | 7.3 | 6.150685 | 6.547945 |
| Mandibular gland | 98.1* | 1.9 | 51.63158 | ||
| Rectum | 53.2 | 32 | 14.8 | 3.5945945 | 2.162162 |
| Salivary gland, cerebral | 62.5 | 16.6 | 20.9 | 2.9904306 | 0.79425836 |
| Salivary gland, thoracic | 45.3 | 18.4 | 36.3 | 1.2479339 | 0.5068871 |
| Sternite | 52.5 | 32.9 | 14.6 | 3.5958905 | 2.2534246 |
| Tergite | 72.2 | 17.3 | 10.5 | 6.8761907 | 1.647619 |
| Ventriculus | |||||
| Thoracic muscle | 79.2* | 20.8 | 3.8076923 | ||
| Fat body | 64.6 | 16.5 | 18.9 | 3.4179895 | 0.8730159 |
| Malpighian tubules | 39.3 | 31.5 | 29.1 | 1.3505155 | 1.0824742 |
| Nerve chord | 32.2 | 12.5 | 55.3 | 0.5822785 | 0.22603978 |
| Poison sac | 50.7 | 49.3 | 1.0283976 | ||
| Sting | 47.1 | 52.9 | 0.89035916 | ||
| Heart | 24.3 | 36.8 | 38.9 | 0.6246787 | 0.9460154 |
| Hypopharyngeal gland | 36 | 64 | 0.5625 | ||
| Galea | 43.4 | 31.5 | 25.1 | 1.7290837 | 1.2549801 |
| Glossa | 21.5 | 38.6 | 39.9 | 0.5388471 | 0.96741855 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 45.4 | 31 | 31.5 | 1.4412699 | 0.984127 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MREIVHIQAGQCGNQIGAKFWEIISDEHGIDPTGTYHGDSDLQLERINVYYNEASGGKYV PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVV EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLSTPTYGDLNHLVSLTMSGVTTCL RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALSVPELTQQMFDAKNMM AACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVKTAVCDIPPRG LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS EYQQYQEATADEDAEFDEEQEAEVDEN |
 Top
| |