| Protein: 48138794 XP_396930.1 PREDICTED: cytochrome b5-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 48.4 | 25.7 | 25.9 | 1.8687259 | 0.992278 |
| Brain | |||||
| Crop | |||||
| Eye | 13.4 | 86.6 | 0.15473442 | ||
| Intestine | 25.7 | 36.6 | 37.7 | 0.6816976 | 0.9708223 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 26.9 | 73.1 | 0.36798906 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 31.3 | 31.3 | 37.4 | 0.8368984 | 0.8368984 |
| Sternite | 15.8 | 35.7 | 48.6 | 0.3251029 | 0.7345679 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 15.7 | 25.7 | 58.6 | 0.26791808 | 0.43856657 |
| Malpighian tubules | 57.7 | 42.3 | 1.3640662 | ||
| Nerve chord | 40.1 | 59.9 | 0.6694491 | ||
| Poison sac | |||||
| Sting | 39.4 | 60.6 | 0.650165 | ||
| Heart | 8.8 | 47.6 | 43.6 | 0.20183486 | 1.0917431 |
| Hypopharyngeal gland | 49.6 | 50.4 | 0.984127 | ||
| Galea | 37.1 | 62.9 | 0.5898251 | ||
| Glossa | 40.5 | 18.5 | 41 | 0.9878049 | 0.4512195 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 26.7 | 36.8 | 52 | 0.51346153 | 0.7076923 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MASENSTVDTAYTKFYTREEVAKHNNNTDLWFIIHNKVYNVTEFTTHPGGEEVLLEQGGQ DCTEVFEDIGHSSDARELMEKFKIGELVEEERTQENNEFTEVSEINGSSCSGAWRSWLIP IALGVLATLVYRYFIKVH |
 Top
| |