| Protein: 48139903 XP_397055.1 PREDICTED: b-cell receptor-associated protein 31-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 48.7 | 1.4* | 49.8 | 0.97791165 | 0.02811245 |
| Scape | 27 | 11.1 | 61.9 | 0.4361874 | 0.17932148 |
| Brain | 50.4 | 49.6 | 1.016129 | ||
| Crop | 42.6 | 57.4 | 0.74216026 | ||
| Eye | |||||
| Intestine | 6.4* | 93.6 | 0.068376064 | ||
| Leg, front | 44.4 | 55.6 | 0.79856116 | ||
| Leg, middle | 54.8 | 45.2 | 1.2123893 | ||
| Leg, rear | 32.8 | 44.4 | 22.7 | 1.4449339 | 1.9559472 |
| Mandibular gland | 9 | 91 | 0.0989011 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 44.7 | 13.8 | 41.5 | 1.0771084 | 0.3325301 |
| Sternite | 3.6* | 12.4* | 84.1 | 0.042806182 | 0.14744352 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 3.5* | 25.6 | 70.9 | 0.049365304 | 0.36107194 |
| Malpighian tubules | 4.5* | 75.7 | 19.8 | 0.22727273 | 3.8232324 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 4.2 | 10.6* | 85.2 | 0.049295776 | 0.12441315 |
| Hypopharyngeal gland | 64.2 | 35.8 | 1.7932961 | ||
| Galea | 32.3 | 67.7 | 0.47710487 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 22.2 | 31.8 | 58.2 | 0.3814433 | 0.5463917 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSLQWTLVAAFLYIEIAVVLLLVLPIISASRWQKFFKSKFLKRLSNQASIYFLILIGILV LFLLDAIREIRKYSMIDEHKEHHLDAEMQGNMRLFRAERNFYISGFALFLCLVIQRLVIL ISTQATLLAQNEAAIRQAQSATTTAKQLLSQKTESTQNDLNEVHNEEITEWKNQIKDLQT KNKELEDQLIKEKKDKEAIKSQAESLAKEYDRLNDEYNNLQSNGDKKSD |
 Top
| |