| Protein: 328777566 XP_395613.3 PREDICTED: hypothetical protein LOC412149 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 31.9 | 26.3 | 41.9 | 0.7613365 | 0.62768495 |
| Leg, middle | 21.3 | 32.4 | 46.3 | 0.4600432 | 0.69978404 |
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 32.2 | 21.9 | 45.8 | 0.70305675 | 0.47816592 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 77.4 | 22.6 | 3.4247787 | ||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 71.9 | 28.1 | 2.558719 | ||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 39.7 | 60.3 | 0.6583748 | ||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.3 | 46 | 40.8 | 0.76715684 | 1.127451 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MATSGSDKKPRIIILGGCGFIGRNLVEYLLDNDLVSFIRVVDKVPPQTAWLNAKHQQLFE HPLLEFKSANLINAVSCQNAFLSDNPIDFVINCAGETKSGQTDPVYKEGIYKLSINCAQQ AAKLQVNHYVEISSGNFNTSEKHPLKEEESGEPWTFVAKYKLQVENDLKNIPNLNYTILR PAIVYGCGDRNGLAPRLVVGAVYKHLGEMMKLLWGPDLHMNTVHVRDVARAIWHVVNSPN TIGKTYNVVDEDDSTQGSISAIVSELFNINHDYWGTALSTLAKTDMSSVVEEVNDKHMGP WAEACNKDGVENSPLSPYIDQELLYNKHLYLQTGKLLSIGFTYLYPKLTKDALKEVLDDY VNMKIFPHSLVL |
 Top
| |