| Protein: 328782015 XP_623727.2 PREDICTED: carboxypeptidase B-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 63.5 | 4.6* | 31.9 | 1.9905956 | 0.14420062 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | 90.4* | 7.2 | 2.4 | 37.666668 | 3 |
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 78.5* | 17.1 | 4.4 | 17.84091 | 3.8863637 |
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 69.6 | 30.4 | 2.2894738 | ||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 62.9 | 37.1 | 1.6954178 | ||
| Heart | 48.5 | 28.6 | 22.9 | 2.117904 | 1.2489083 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 70.1 | 24.1 | 21.5 | 3.2604651 | 1.1209302 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MRVFFLIATIFVAAALAVDHEVLPSLRGMQSISISYQTPEQFSFLKNFMDTPGFEFVKTT SDLVDVLVTGDKVESFKQLLDEENMDYTVMIEDVEEIVTEEYITQEVERRLKSRIQEDYA SGRLSFTYYPKYNEVNEYLDYLTKTYGNVASLITIGNSYEGRVMKVLKLSTGGKNKPAIF IDGGIHAREWIAPATVLYMVDLMLSSHKDLLNKVDWYVLPVLNPDGYEFTHTKSANRLWR KTRSPNKGSNCVGVDGNRNYDMGWMEIGASNNPCSETYAGPKAFSEVENQHLRDFILARK GQFKAYLTFHSYGQYILYPWGFTSQVPSNEPELRNLASSCAKAIAKSRKTQYTYGTSANH LYPAAGGSDDWAMGKAGINLSYTFELPGGNYGFLLPASEIKAVGTETFEAIKQIHQYVTS KYASR |
 Top
| |