| Protein: 328792220 XP_003251696.1 PREDICTED: proteasome subunit alpha type-6-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 37.7 | 32.7 | 29.6 | 1.2736486 | 1.1047298 |
| Scape | 32.5 | 29.2 | 38.2 | 0.8507853 | 0.7643979 |
| Brain | 54.5 | 45.5 | 1.1978022 | ||
| Crop | 31.5 | 30.5 | 38 | 0.82894737 | 0.80263156 |
| Eye | |||||
| Intestine | 28.2 | 44.3 | 27.5 | 1.0254545 | 1.6109091 |
| Leg, front | 34.1 | 34.5 | 31.4 | 1.0859872 | 1.0987262 |
| Leg, middle | 30.7 | 35.4 | 33.9 | 0.9056047 | 1.0442477 |
| Leg, rear | 39.9 | 26.1 | 34 | 1.1735294 | 0.7676471 |
| Mandibular gland | 24.6 | 75.4 | 0.32625994 | ||
| Rectum | 14.8 | 55.6 | 29.6 | 0.5 | 1.8783784 |
| Salivary gland, cerebral | 36.9 | 14.4 | 48.7 | 0.7577002 | 0.29568788 |
| Salivary gland, thoracic | 37.5 | 28.4 | 34.1 | 1.0997068 | 0.83284456 |
| Sternite | 30.9 | 38.9 | 30.2 | 1.0231788 | 1.2880795 |
| Tergite | 30.2 | 41.9 | 28 | 1.0785714 | 1.4964286 |
| Ventriculus | 33.7 | 28 | 38.3 | 0.87989557 | 0.7310705 |
| Thoracic muscle | |||||
| Fat body | 31.1 | 30.3 | 38.6 | 0.80569947 | 0.7849741 |
| Malpighian tubules | 26.3 | 32.5 | 41.3 | 0.63680387 | 0.78692496 |
| Nerve chord | 31.3 | 26.7 | 41.9 | 0.7470167 | 0.6372315 |
| Poison sac | |||||
| Sting | 53.1 | 46.9 | 1.1321962 | ||
| Heart | 22.5 | 40.9 | 36.5 | 0.6164383 | 1.1205479 |
| Hypopharyngeal gland | 51.4 | 48.6 | 1.0576131 | ||
| Galea | 32.3 | 67.7 | 0.47710487 | ||
| Glossa | 15.8 | 42.5 | 41.7 | 0.3788969 | 1.0191847 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.1 | 36.8 | 40.2 | 0.74875623 | 0.91542286 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MARGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVKGVDTAVFATQKKVAISV GAKQTEANSYLEKKLKKKQNYDHDETIQLAITCLSTVLSVDFKPTEIEVGVVSKDNPKFR TLTEQEIDKHLTAIAEKD |
 Top
| |