| Protein: 328776929 XP_623150.3 PREDICTED: serine proteinase stubble isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 9.3 | 64.3 | 26.3 | 0.35361215 | 2.444867 |
| Scape | 15.1 | 66.6* | 18.2 | 0.8296703 | 3.6593406 |
| Brain | |||||
| Crop | 43.4 | 19 | 37.6 | 1.1542553 | 0.5053192 |
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | 58.1 | 41.9 | 1.3866348 | ||
| Leg, rear | 81.2* | 18.8 | 4.319149 | ||
| Mandibular gland | 16.4 | 83.6 | 0.19617225 | ||
| Rectum | 62 | 38 | 1.6315789 | ||
| Salivary gland, cerebral | 26.3 | 37 | 36.7 | 0.7166213 | 1.0081744 |
| Salivary gland, thoracic | 31.4 | 22 | 46.5 | 0.6752688 | 0.47311828 |
| Sternite | 8.6 | 63.6 | 27.8 | 0.30935252 | 2.2877698 |
| Tergite | 11.5 | 19.9 | 68.6 | 0.16763848 | 0.29008746 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 24.7 | 11.5 | 63.8 | 0.38714734 | 0.18025078 |
| Malpighian tubules | 49.6 | 24 | 26.4 | 1.8787879 | 0.90909094 |
| Nerve chord | 18.8 | 35.7 | 45.5 | 0.41318682 | 0.7846154 |
| Poison sac | |||||
| Sting | 13.4 | 86.6 | 0.15473442 | ||
| Heart | 11.4 | 35.3 | 53.3 | 0.21388368 | 0.6622889 |
| Hypopharyngeal gland | |||||
| Galea | 16.6 | 41.6 | 41.8 | 0.39712918 | 0.9952153 |
| Glossa | 6.7* | 37.9 | 55.3 | 0.12115733 | 0.6853526 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 23.2 | 39.7 | 45.4 | 0.5110132 | 0.8744493 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAMRKIFLILGMVSCSIAAPQNNNLDSLITNIFGTPQNPQISDPSSTTSDTILGTENRPK QPETNCECVPYYLCHNGSILENGTGIIDIRLGFDDESVTKHRTSRALGQCENYLDVCCKP PDRIEKVTPPPVEKKGTCGQRHPQGVGFRITGDVNGEAQFGEFPWMVAIIKEENIGEEKL NVYQCGGSLIHKQAVLTAAHCVQGKQASELRIRAGEWDTQTKNEIFPHQDRNVQNVIIHE NFAGGTLYNDFAILILSEPLNLMENVDLVCLPERNTVFDGTRCFASGWGKDKFGKEGHYQ VILKKINLPVVPHNQCQDLLRKTRLGKYFVLDSSFICAGGESDKDTCKGDGGSPLVCPSN SNPNIYLQAGIVAWGIGCGEGGIPGVYANVASVRDWIDEQMAFYNLDNTVYQAQKIN |
 Top
| |