| Protein: 110763826 XP_395047.3 PREDICTED: phosphoglycerate kinase isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 26.7 | 42.8 | 30.5 | 0.87540984 | 1.4032787 |
| Scape | 22.9 | 40.3 | 36.7 | 0.6239782 | 1.0980927 |
| Brain | 40.7 | 29.9 | 29.4 | 1.3843538 | 1.0170068 |
| Crop | 55.1 | 14.1 | 30.9 | 1.7831715 | 0.4563107 |
| Eye | 28.8 | 35.4 | 35.8 | 0.8044693 | 0.9888268 |
| Intestine | 33.6 | 35.2 | 31.2 | 1.0769231 | 1.1282052 |
| Leg, front | 34.1 | 35.1 | 30.8 | 1.1071428 | 1.1396104 |
| Leg, middle | 33.3 | 34.5 | 32.2 | 1.0341614 | 1.0714285 |
| Leg, rear | 30.7 | 35.9 | 33.4 | 0.9191617 | 1.0748503 |
| Mandibular gland | 61 | 2 | 37.1 | 1.6442049 | 0.053908356 |
| Rectum | 19.5 | 46.7 | 33.8 | 0.5769231 | 1.3816568 |
| Salivary gland, cerebral | 32.1 | 24.9 | 43 | 0.74651164 | 0.5790698 |
| Salivary gland, thoracic | 26.9 | 42.6 | 30.5 | 0.8819672 | 1.3967214 |
| Sternite | 36.8 | 42 | 21.2 | 1.735849 | 1.981132 |
| Tergite | 38.1 | 41.5 | 20.5 | 1.8585366 | 2.0243902 |
| Ventriculus | 28.8 | 45.3 | 26 | 1.1076924 | 1.7423077 |
| Thoracic muscle | 33.4* | 58.8 | 7.8 | 4.282051 | 7.5384617 |
| Fat body | 43.2 | 37.1 | 19.7 | 2.1928935 | 1.8832487 |
| Malpighian tubules | 31 | 38 | 31 | 1 | 1.2258065 |
| Nerve chord | 28.6 | 43.9 | 27.4 | 1.0437956 | 1.6021898 |
| Poison sac | |||||
| Sting | 52.3 | 47.7 | 1.096436 | ||
| Heart | 48.6 | 21.9 | 29.4 | 1.6530613 | 0.74489796 |
| Hypopharyngeal gland | 56.3 | 43.7 | 1.2883295 | ||
| Galea | 24.3 | 45.6 | 30 | 0.81 | 1.52 |
| Glossa | 19.3 | 52.9 | 27.8 | 0.6942446 | 1.9028777 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.8 | 38.2 | 30.7 | 1.1009772 | 1.2442997 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MALNKLSIDKVDLTDKRVLIRVDFNVPLKDGKITNNQRIVAALDTIKYALSKKAKSVILM SHLGRPDGKKDMKYTIKPVADELKSLLGKEILFLNDCVGSEVENACANPEPGSIILLENL RFHIEEEGKGVGEDGKKIKADKTKVDEFRKSLRKLGDIYVNDAFGTAHRAHSSMLGEGYE TRASGFLLKKELEYFAKALENPERPFLAILGGAKVADKIQLIDNLLDKVNEMIIGGGMAY TFLKISKNMKIGNSLFDEEGAKIINNLLSKAEKNKVQIHLPIDFVTADKFAENATVGAAD IESGIPDGWMGLDVGPKSRELFSQPIKRAKTIVWNGPAGVFEFENFSKGTKSLMDNVVEA TSKGAISIIGGGDTATCAAKWKTEDKVSHVSTGGGASLELLEGKVLPGVAALSSL |
 Top
| |