| Protein: 110764343 XP_001120260.1 PREDICTED: sorting nexin-2-like isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 47.1 | 52.9 | 0.89035916 | ||
| Scape | 36.3 | 26.1 | 37.6 | 0.96542555 | 0.69414896 |
| Brain | 18.4 | 81.6 | 0.2254902 | ||
| Crop | |||||
| Eye | |||||
| Intestine | 59.8 | 40.2 | 1.4875622 | ||
| Leg, front | |||||
| Leg, middle | 56.7 | 43.3 | 1.3094689 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 83.9 | 16.1 | 5.21118 | ||
| Salivary gland, thoracic | 39.3 | 15.6 | 45.1 | 0.8713969 | 0.345898 |
| Sternite | 63.7 | 36.3 | 1.754821 | ||
| Tergite | |||||
| Ventriculus | 34.6 | 65.4 | 0.52905196 | ||
| Thoracic muscle | |||||
| Fat body | 16.9 | 59.9 | 23.2 | 0.7284483 | 2.5818965 |
| Malpighian tubules | 37.7 | 34.5 | 27.8 | 1.3561151 | 1.2410072 |
| Nerve chord | 38.3 | 26.2 | 35.6 | 1.0758427 | 0.73595506 |
| Poison sac | |||||
| Sting | |||||
| Heart | 25.6 | 46.1 | 28.3 | 0.90459365 | 1.6289753 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 40 | 40.7 | 41 | 0.9756098 | 0.99268293 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MADIKESPPLFDTNETKVDDLDDDDEDIFASAVQDQSQLEDSPPYNGVSTIQTELPKLTL RDVPEENSFSSVSSPAPGPLNSPLGPMSTDIGDLHDVPINDNTDILSTNVMQTQSTDMVS TDSSDVFLKITVTSPQKIGDGMGAYVAYKVETKTNMPIFRKRNFSVIRRFSDFLGLHDKL TDKYLRNGRIIPPAPEKSVIGTTKIKMSGDKNQEQNSSSTEFIEKRRAALERYLNRTAAH PVLSVDPDFREFLEADMELPKATNTSALSGKGVMRLFNKVGETVNKITYKMDETDKWFEE KTSQIEIDSLDVQLRALHSAVDTLTNQRRELATCTGATARSIAVLGHGEPGASLGRALAQ LAETLEKVEVIRRAQSNSDLYQFGEMLRDYVALIGAIKDVFHERVKVFQNWQHAQMMLNK KREQKARLEQSGRTDKTSQAATEVIEWEAKVDRGQEEFDNISKMIKKELERFELVRVEDF KKQLTEYLESMLQYQNQLIKYWESFLPEARAVA |
 Top
| |