| Protein: 328784624 XP_003250473.1 PREDICTED: stromal cell-derived factor 2-like protein 1-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 39.3 | 18.7 | 41.9 | 0.9379475 | 0.44630072 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 60.1 | 39.9 | 1.5062656 | ||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 24 | 56.5 | 19.5 | 1.2307693 | 2.897436 |
| Malpighian tubules | 35.9 | 30.1 | 34.1 | 1.0527859 | 0.88269794 |
| Nerve chord | 57.8 | 7.9 | 34.3 | 1.6851312 | 0.2303207 |
| Poison sac | |||||
| Sting | |||||
| Heart | 21.3 | 49.1 | 29.6 | 0.7195946 | 1.6587838 |
| Hypopharyngeal gland | 33 | 67 | 0.49253732 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.6 | 36.5 | 38 | 0.9368421 | 0.9605263 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MRQLKGKTKETNKQKKERKKEFLENKQRVFTVVLPTIAAIFVIIAAYVYVKTPKGTQHVT CGSTLKLMNVNYKVRLHSHDIKYGSGSGQQSVTGTSAKEDGNSYWLVKAGTKKQCTRGIP IKCGDIIRLEHIATKKNLHSHRVSSPLSGKQEISAYGDNKGEGDNGDNWLLICQTEFWRR DESIMLKHVDTDTYLAVSGRVYGNPITGQTEVVGEYSSNSPHIEWMTTEGVFIHPNDFKA QHHIHTEL |
 Top
| |